CAZyme Information: CVL00961.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL00961.1
• CAZy Family: GH39
• CAZyme Description: Related to beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1L7U0C6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		43873.98	7.7650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000011:1151520-1152650(-)

Full Sequence      

MASRVPYRVFLSLILLVCVVVLLSKQPFFDRSHIHRITDTDISVSLSLPRLNFSRSHHEY
YASDAARSLCASHGYTVFNPHPDAPNGRRKIYDLFMVNTELDFLEIRLKTLYNYVDYFVV
VEAPLTFQGGPKDLVIRDNWKRFEPYHDKMIYHQLEYPKDFKPLRHWDREDLQRNAMFDQ
VFPKLTGEQTPTQGDVILVADVDEILRPATMLVLRTCNFPRRLTLSSKFYYYSFQFLHDG
PEWPFPQATYYQGMRNTILPGNLRTGDAGIPLLRDLEKGTLANAGWHCSSCFSTMGQFLN
KMASFSHAWMNHESFRDRDRIASAIREGVDLWGRKENTFTRIDSNADLPTCLLEDRERFR
YMLDRSGKTAGFSDYP

Enzyme Prediction     

No EC number prediction in CVL00961.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	67	364	4.6e-82	0.9859154929577465

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	2.29e-51	60	363	50	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58310.1|GT17	6.45e-286	1	376	1	376
QGI84149.1|GT17	3.07e-284	1	376	1	376
QGI97798.1|GT17	3.07e-284	1	376	1	376
CCT71189.1|GT17	3.07e-284	1	376	1	376
QGI66912.1|GT17	3.07e-284	1	376	1	376

PDB Hits     

CVL00961.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09327|MGAT3_HUMAN	4.39e-10	89	364	206	499	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT3 PE=1 SV=3
sp|Q02527|MGAT3_RAT	4.42e-10	89	364	210	503	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=Mgat3 PE=1 SV=2
sp|Q10470|MGAT3_MOUSE	5.88e-10	89	364	210	503	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Mgat3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996477	0.003548

TMHMM  Annotations     

Start	End
7	24