CAZyme Information: CVL00705.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL00705.1
• CAZy Family: GH36
• CAZyme Description: Related to beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TYC3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		44034.92	7.5239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000011:689400-690524(+)

Full Sequence      

MVPKAVFRGILFIGICSLLWWTFRPLRGSRAVFTESLQSIDFLSPTSHYGRKTSELYASR
AAHDLCSVHGYSAFVPKSPSSERKVYDMLMINDELDFLEIRLDALYDYVDYFIIVESPKS
FQANSKPLILKENWDRFRRYHHKIIYHELVFPSNFDPNRAWDYEDLQRDAPFDQVMLSLD
GPRAPNKGDVLIVADVDEIPRPQTLLILQYCNFPRRLTLSSKFYYYSFQFLHTGPEWQHP
QATYYQGHRTLKPTNLRNGDGGFRPFRFLERDVLSNAGWHCSSCFPTIDQFLNKMESFSH
RWMNREEYRDKDKIAAAVREGKDLWGREHDQFLRIEDNKDMPPLVLNEPNRFGYMISRDG
PSAGFVDYNRKEKS

Enzyme Prediction     

No EC number prediction in CVL00705.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	63	355	5.8e-79	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	4.31e-48	61	326	56	300	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71044.1|GT17	1.68e-271	1	373	1	373
QGI83999.1|GT17	1.68e-271	1	373	1	373
QGI66762.1|GT17	1.68e-271	1	373	1	373
QGI97648.1|GT17	1.68e-271	1	373	1	373
QKD58150.1|GT17	1.51e-259	1	373	1	373

PDB Hits     

CVL00705.1 has no PDB hit.

Swiss-Prot Hits     

CVL00705.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995705	0.004313

TMHMM  Annotations     

Start	End
5	23