CAZyme Information: CVL00493.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL00493.1
• CAZy Family: GH36
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7TWI4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	FCQH01000011|CGC4	60614.83	6.5453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000011:373862-375496(-)

Full Sequence      

MTTVTLPPGADRSYDYVIVGGGTAGCVLGTRLAQYLPECRVLIIEAGPSDHNIPTVQNLK
EWLSVLGGDLDYDYETTEQPNGNSHIRHSRAKVLGGCSSHNTMIAFRPFRYDMERWVAKG
CRGWDWETMMGHIDHLRNQIQPVHNRHRNQLTKDWIKSCSTAMDIPIIQDFNTEILDKGQ
LSEAVGFFNIAYNPDTHQRSSASVAYVHPIIRGEERRPNLTILTEAHVSKINIEKSIADS
VDITLKSGDRYTVVPRKEIILCGGAIDTPRLMLLSGLGPRGQLEELGIEVTKDIPGVGEN
LQDHAEGIITWELDRQVPQNKTTMNSDAGLFLRREPVGAAGDDGNAADLMMHCYQACYSH
HTTRMGFEDIPEPYVFSMTPNIPRPRSRGRVYLKSADPKVKPALDFQYFSDPEGYDDATM
TWGIKMARKIAKESPFKDWLRREVAPGPAVQTDEDISKYVRSVHHTVYHPCGTTKMGDPT
HDKMAVVDPELRVRGVKRLRIADAGVFPDVPTINPMLTVLAVGERAAELIATGEGWRPGP
SANL

Enzyme Prediction     

No EC number prediction in CVL00493.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	531	3.5e-138	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.20e-108	10	531	4	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.33e-108	10	530	2	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.25e-46	385	526	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.05e-29	9	523	51	569	Protein HOTHEAD
366272	GMC_oxred_N	1.06e-22	14	304	1	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52860.1|AA3_2	2.15e-300	1	538	1	538
QGI77692.1|AA3_2	4.33e-300	1	538	1	538
CCT64188.1|AA3_2	4.33e-300	1	538	1	538
QGI60495.1|AA3_2	4.33e-300	1	538	1	538
QGI91399.1|AA3_2	4.33e-300	1	538	1	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.72e-121	10	530	10	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.84e-121	10	530	10	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.08e-120	10	530	10	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4UDP_A	1.68e-58	11	532	3	529	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	6.30e-58	11	532	3	529	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.40e-120	10	530	10	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	7.06e-79	12	537	5	540	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.27e-73	14	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q9X2M2|BETA_STAXY	1.48e-72	12	530	3	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus OX=1288 GN=betA PE=3 SV=1
sp|Q4A0Q1|BETA_STAS1	5.66e-72	12	530	3	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999898	0.000143

TMHMM  Annotations     

There is no transmembrane helices in CVL00493.1.