CAZyme Information: CVL00442.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL00442.1
• CAZy Family: GH35
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TUD3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		87227.68	5.3427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000011:293719-296261(+)

Full Sequence      

MDFQSLLPELTFEEKVSLLSGRDFHAAAGIDRLGIPPMKVANSVNGIGPHDMELEVTTAS
FPSTTCYGSTFDAELLGRLGEELAVQARLKSAQLVLGPTINIHRDPRGGRNFECFSEDPL
WPASWGYCQRLTSRRSWLDGRTLREIYLAAWQHLLRTSDPEGVMTAYNKVDGQFCSANPD
LIERVLRRDWAFKGMTMSDWFGVHDTVGPIKAGLDLEMPFPVFRASKLVEAVHCGAVTEE
EINNRVKMMLELRNRTRSCHDQKPERSEIRDEENKLAWEIATSGIVLLKNANKALPLSPA
DSQKIALIGEFSADPVITGGGSASCIPQYRLSPLDVMRKEFPSVKCALGVRTRRLIPIAP
TEQLISADGRPGVDIKYYDEESSELLLSEFQAKPHVWMLGRFKPELKVPGCNLQLITKLI
PLSTGRHTLAVRCTGSFSVAINDKIVLTGPAKDISTEQFIFNPILLESRLQVLMEAGKSY
DIRVIVKGPEELAVGEPTPFSATLCFEEYRSEEEAIAEAAKLASESDISIIYAGRSDQYE
SEGFDLEDMHMPLNQTALIKAVAAVSKKTVLVLHCGNPINVNPFVDDVDAILNAHFPGQE
GARAVTDILTGKVCPSGRLATMWFKTLEDCPSFEHFSPTAVEDGNIYLEYKEGLEVRYRC
RDSQSRVRWPFGFGLSYTNFSYSGLRATVDGESTEPKLKCHVEVKNTGAVSGKEVVHLYI
KPAKDTLVWRPERELKAFTRVSLQPGVSQLVKLEVELDVACSYWDENEVAWRIQPGIYKA
CIAD

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	135	219	4.5e-20	0.4166666666666667
GH3	28	121	1.1e-17	0.4074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.58e-43	61	782	120	750	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.59e-41	285	677	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.06e-40	4	775	54	760	Probable beta-xylosidase; Provisional
224389	BglX	1.05e-34	22	327	47	376	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.97e-20	32	252	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI65540.1|GH3	0.0	2	783	10	818
UQC84261.1|GH3	3.92e-313	2	784	872	1676
QKD60029.1|GH3	1.09e-281	1	784	1	813
CCT73941.1|GH3	5.06e-270	1	784	1	804
QGI86914.1|GH3	5.06e-270	1	784	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.57e-115	2	782	5	821	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.21e-111	2	782	5	821	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.34e-93	1	782	3	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.43e-83	9	778	11	644	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.38e-72	6	779	7	695	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	6.55e-119	4	782	12	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.84e-118	6	783	5	796	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.41e-113	1	782	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.41e-113	1	782	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.82e-113	1	782	4	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998828	0.001196

TMHMM  Annotations     

There is no transmembrane helices in CVL00442.1.