CAZyme Information: CVL00308.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVL00308.1
• CAZy Family: GH33
• CAZyme Description: Related to beta-mannosidase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TNS8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		92452.16	5.6656

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000011:105290-108114(+)

Full Sequence      

MPPIAQRTLLEKGWSFKKATDGHDAWKPVARVPTVAHIDLIENGIIPDPFLDMNELQVEW
VGETAWTYRTTFDSPSANSRSVYLIFEGLDTFAQVKLNDIVILESDNMFLSHRVDITNKL
CNEGTNLLSIDFDSALLKAREITKQYPDHRWELFNGEAGRLVVRKAQYHWGWDWGPVLNT
AGPWKPVWLEVSSAHINNFLINYSVSPDLETVQGTVEIDVEGHHDTANVSIRFQDNVVCD
TAAAKSSSGRLVVPFAIDHPKLWYPAGYGHQSQYTVSVSIVKDGQKLDAKTKKTGFRRSE
LVQKGDSHGKSFFFRINNIDVFSGGSCWIPADNFLPRITASKVWGGGIYEDDAFYDCCDD
MGILVWQDFMFGCGNYPVGPELIRSVREEAVQNVSRLHHHPSVVIYAGNNEDYQVQEQAG
LEYNPDDKDPSSWLKSSFPARYYYEHLLPEVVSEVSPGMTYWPGSPFSGGKDTTDKTTGD
LHQWNVWHGTQEKYQVFDRLGGRFNSEFGMEAFPALSTIKHCITEECDRFPQSQMMDFHN
KADGHERRIATYVVENFRPLPDLESHIYLTQLCQSEAMTFAYRSWRRQWGDDRRCGGVLV
WQMNDCWPAISWSIVDYFLTKKPAYYSIRRALKPIAAGVQRQHHDWSVVHARPAKASSFE
VWVASNKQEEITVTVEIRFISIKTGSDIRDKVVKANTVLIPNGTTDILTGQIDNVKDEPH
VISVRVFQGDTCVSQDVDWPQPLKYLDFSDRGVEVQVGPDGYQLTANKPTKGLVFEELPG
ISLEDNCIDLMPGEVATVKVKGGVMLSGVPKYRYLR

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	660	1.2e-82	0.6409574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	5.24e-69	3	629	8	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	1.09e-11	194	297	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	3.73e-11	657	745	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT70824.1|GH2	0.0	1	816	1	833
QGI83791.1|GH2	0.0	1	816	1	833
QGI66550.1|GH2	0.0	1	816	1	833
QGI97440.1|GH2	0.0	1	816	1	833
QKD57951.1|GH2	0.0	1	815	1	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.04e-143	10	640	29	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	3.00e-112	11	807	21	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	3.07e-112	11	807	21	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.13e-111	11	807	19	837	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.18e-111	11	807	21	839	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB7|MANBB_ASPOR	0.0	10	815	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	0.0	6	815	5	843	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	10	815	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	0.0	6	815	5	843	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	0.0	10	815	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CVL00308.1.