CAZyme Information: CVK98030.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK98030.1
• CAZy Family: GT8
• CAZyme Description: Related to mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TH75]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48136.48	7.1048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000009:210558-212006(-)

Full Sequence      

MKHQYVLPVVFLRPSRRIRLLAFLSFFVTATWIFITRSSIACSQERDIAREYPLVYRHIH
SFNGSGGAWYIPPYWADTEQPQNILDAARIVSQSALLNRERRIPFSNIPLIVHQTWKTTA
ADTWSPRILPWVELWLENSIYVDRGPSMAYLFWDDTGMRALVEEFENDSLERYDSLLTPV
ERSDVFRILVCRHFGGIYGDLDTELIRHPAAWISGSDMASWIDPKTGKAYGYYNTSVTPD
YETPVVNLLWGLEADNDPESDAYWRQSYTYPQQLSQWAFAAAPQHPVFERYMDNLRNYTK
DNETAAQNSDPLKRTGPAAVTLATKSWLEDHASFRWASLTGVKDGGKSKLVEDILILPIT
GFQLLTLRSPSHGSRNDVMGRKPVTDPAARLCHHGTGLWKHFNFVGEYGKGLAKVNRIRE

Enzyme Prediction     

No EC number prediction in CVK98030.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.55e-16	108	296	82	244	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.11e-08	146	217	16	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73207.1|GT32	5.52e-290	1	418	1	413
QPC63324.1|GT32	2.04e-220	1	410	1	406
QKD59215.1|GT32	1.30e-197	78	363	3	288
CEF84399.1|GT32	2.46e-184	31	363	14	348
CZS74875.1|GT32	3.49e-184	31	363	14	348

PDB Hits     

CVK98030.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	8.62e-09	108	213	57	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.19e-06	108	202	62	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.44e-06	108	202	82	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.61e-06	108	202	55	140	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P31755|OCH1_YEAST	1.95e-06	108	295	96	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.862049	0.137955

TMHMM  Annotations     

Start	End
21	40