CAZyme Information: CVK95797.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK95797.1
• CAZy Family: GH16
• CAZyme Description: Pectinesterase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7TKH8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	FCQH01000007|CGC22	36288.34	7.1802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000007:1665025-1666339(+)

Full Sequence      

MPFPKSFLHLVQLALFVGQVPSSVEAARLPTRADNSRTVAPANCIVVRPSGASASEFTSL
QAAVNSIGSSTTPTCIFLNSGTYNERVEIKVKAPLTLYGATADTGSYKKNTVVIQNTLGS
QDAGSLDASSTVNLRSNDFAAYNIDFVNGYTAGQAVALTANGNKTGFYGCSFKSYQDTLY
VKAGWMYYSNCYIEGVVDYIFGNGHAWIGESTIASNGPGYITASSRTEPTDTSRYIIDHS
TITSTGTQDLTNKVYLGRPWRVNARVMYQYSTLTNVVRPEGYSPMAEGATPVFQEFGNTG
AGADTSQRKYFTPSDKALTKQDLWGADFKWYDTSY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	53	312	2.5e-75	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215357	PLN02665	1.37e-46	45	321	70	343	pectinesterase family protein
395871	Pectinesterase	1.22e-45	45	308	2	271	Pectinesterase.
178113	PLN02497	2.94e-44	42	308	31	299	probable pectinesterase
178051	PLN02432	3.85e-43	45	308	11	265	putative pectinesterase
178372	PLN02773	5.86e-42	44	308	4	275	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60537.1|CE8	3.67e-228	1	335	1	335
CCT74773.1|CE8	5.87e-183	1	335	1	323
QGJ01073.1|CE8	5.87e-183	1	335	1	323
QGI70184.1|CE8	5.87e-183	1	335	1	323
QGI87544.1|CE8	5.87e-183	1	335	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	5.45e-97	36	335	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	7.72e-97	36	335	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	8.77e-28	76	308	39	278	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.14e-17	76	308	35	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	7.70e-15	56	260	43	269	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBT5|PMEA_ASPFU	1.63e-106	14	335	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.63e-106	14	335	5	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.07e-104	8	335	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	2.70e-100	36	335	28	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q2UBD9|PMEA_ASPOR	1.05e-99	10	335	5	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999756	CS pos: 26-27. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in CVK95797.1.