CAZyme Information: CVK95549.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK95549.1
• CAZy Family: GH16
• CAZyme Description: Pectate lyase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TC77]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	FCQH01000007|CGC16	37553.43	3.6451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000007:1284924-1286088(+)

Full Sequence      

MAATLAIGAYAAPAPLITGAPSLSRRQDSEGGSGGSGGSSVLDAPMTIAAGESFDGANAI
FDRGVSCTGQEEGGDSDAVFILEKGATLSNVRIGPNQIEGVHCNGGCTLNNVVWDAVCED
AFSIKKQEDGETTTINGGGATGAEDKVIQHNGGGTVIIKDFEVSDFGKLYRSCGNCKEMP
ARHVEISGGSASNGKILVGINPNMGDTAKISGIQLTNVPKECITFEGVTDGSEPKEVGTC
DSNAGSGSGSGSGDSTEAPATPTTPADGSETPAASEVADPVETSSDGSQGDDQSGDDQSG
DDQSGDDQSGDSNDSENDDSDDDNSDDNSDDENKEEQSDNENQEQGSESENQQAQPSQPN
FNFGSGGFGGF

Enzyme Prediction     

No EC number prediction in CVK95549.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	38	227	2.8e-72	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	2.59e-101	41	232	12	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74639.1|PL3_2	6.65e-203	1	371	1	361
QGJ00946.1|PL3_2	8.28e-203	1	371	7	367
QGI70056.1|PL3_2	8.28e-203	1	371	7	367
QKD60682.1|PL3_2	7.27e-196	1	371	7	373
QGI87418.1|PL3_2	4.66e-195	1	362	7	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	6.32e-25	64	236	22	205	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	8.51e-25	41	232	4	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B4N_A	4.05e-24	45	236	111	323	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	1.23e-18	41	175	9	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.25e-18	41	175	10	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ATC7|PLYH_EMENI	2.86e-68	51	237	57	243	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q0CJ49|PLYD_ASPTN	3.25e-68	42	244	43	243	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	9.46e-68	42	236	45	236	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|Q4WGV9|PLYD_ASPFU	1.83e-67	42	244	31	232	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	1.83e-67	42	244	31	232	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.469875	0.530125	CS pos: 20-21. Pr: 0.2709

TMHMM  Annotations     

There is no transmembrane helices in CVK95549.1.