CAZyme Information: CVK94848.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK94848.1
• CAZy Family: GH131
• CAZyme Description: Related to glucan 1,3-beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1L7T7Y3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	FCQH01000007|CGC21	33394.18	9.8669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000007:205533-206490(-)

Full Sequence      

MKLFGSIGAVAAALMLLPGQALAGQYKGFSMGANRADGLCKYTADWKKDFQTIKSWNKGF
NAVRLYSADDCNTLVKAVPAAKQTGMKILVGVWATDDAHFGRDKAALLKVIKQYGTDWIA
AISVGSEDLYRKDISPDKLAQQIYDVRGMVRQFNKNLKVGHTDTWTAWVDGRNDVVTKAC
DIAITNGFPYWQGVPIKEALQKKTFQNSYWSVQKHVKAVNSKAAVWVGETGWPTKGANYQ
KAAATTASLQSYYNNVGCWLWQQKDASGFWFTAFDAPLATPEVEANFGIANKDRKLKFSL
TC

Enzyme Prediction     

No EC number prediction in CVK94848.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	49	302	3.7e-31	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.01e-57	18	294	37	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.15e-17	28	302	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74252.1|GH17	7.14e-223	1	302	1	302
QGI87033.1|GH17	7.14e-223	1	302	1	302
QGJ00576.1|GH17	7.14e-223	1	302	1	302
QGI69688.1|GH17	7.14e-223	1	302	1	302
QKD61100.1|GH17	5.86e-222	1	302	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.68e-32	26	301	37	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.99e-31	26	301	37	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	4.04e-62	29	302	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	6.18e-49	1	302	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q4WG16|EGLC_ASPFU	8.23e-43	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	8.85e-43	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	3.44e-41	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999728	CS pos: 23-24. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in CVK94848.1.