CAZyme Information: CVK93906.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK93906.1
• CAZy Family: GH12
• CAZyme Description: Related to L-sorbosone dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A0A1L7TGJ3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	FCQH01000006|CGC11	51497.93	8.9501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000006:1518336-1519844(-)

Full Sequence      

MTSLRMVVAIALISTFITSFASAQQCSYKVTKPKFSSPRTAPGWEYAVLRDNFRQPRTIL
FDSEGALLILDAFRGIVHLQLDDSDVGGKCVRIAKKTTLLKKGSLRQGLALSKDGRTIYA
SSSSSVWSYSYDAKNVKLDKGSEKMVVDNLATEGSSWRSLLISQKNPDMLVVSRGSGIGN
DPLAEVRSSGHAQIRAFNISTFDPKFPDMKPYDFAKDGVLLGWGRRNSQGLAEHPITGGI
FSTENSYVALDRNGKDISVDNPGEEMNFHGYLNGSTESSGGNYGYPFCYSLWSTSKFPEI
GDIKIGEQFGADQKSDRSRRTDAECRRDYVAPVQVFQAQSAPIALEFNPDGTRAYMAFHG
SWNRMKPVGYQVAYIDFKNGQPAIDAIKSGNATTPIMFNKDNNTHCPEDCFRPAGLAWDK
KNRLFFTSDTTKEVFVLYNTWDAYLKKNDTHEAYVWRGDKGSR

Enzyme Prediction     

No EC number prediction in CVK93906.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	30	437	6.3e-153	0.9900249376558603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.05e-15	3	369	7	351	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64621.1|AA12	0.0	1	463	1	454
QGI60952.1|AA12	7.94e-301	1	445	1	436
QGI91853.1|AA12	7.94e-301	1	445	1	436
QKD53338.1|AA12	8.19e-205	13	457	6	441
QKD50391.1|AA12	3.12e-175	15	437	11	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1T_A	5.44e-117	26	437	1	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1Q_A	1.02e-116	35	437	8	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.06e-116	35	437	9	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	1.96e-41	30	437	3	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	6.19e-10	108	435	165	439	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1
sp|O51055|Y024_BORBU	7.80e-06	156	438	148	375	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000440	0.999524	CS pos: 23-24. Pr: 0.9621

TMHMM  Annotations     

There is no transmembrane helices in CVK93906.1.