CAZyme Information: CVK93883.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK93883.1
• CAZy Family: GH12
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A1L7TCM2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	FCQH01000006|CGC1	46821.93	8.1447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000006:1472561-1473890(-)

Full Sequence      

MGFLNHETNPISSLTAAFAAWKGLFLAIALGASVGSDYDTSTSLFFNIVHGPTTPVPALA
TRLTRWDALYFMHDAVKGKVYEQEWAFGIGLPAVVRGINVLFGLEEGWDAIIAIAISHVS
HLIAVLALYQLTIVLCNDRKLAYLAAAVHILSPGGLFLSAPYAESTFACLSFVGNLLFAL
GLKSSPDSMRRNISVIGAGFLYGVSCVFRSNGLFGGVLFAVEAIKGLTALLGGFSFFKVL
RLAAPIIGGLFVAVGFVAPQILAWMRYCNVQDNEEQRPWCTRPLPSIYTFVQEEYWNVGF
LRYWTPNQIPLFLLAAPMLTILIKSGKEVMQEPSRGLRAMISGTDEQCRMLVRTLAAVQT
LLAVLAITNYHVQIISRISSAYPVWYWWVASCLMDKQRQDLGYGIVVFISMYAMIQGGLF
ASFLPPA

Enzyme Prediction     

No EC number prediction in CVK93883.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	18	427	3.2e-111	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.54e-35	38	427	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.04e-21	65	427	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64606.1|GT76	3.46e-300	1	427	1	427
QGI91835.1|GT76	1.24e-240	1	351	1	351
QGI60934.1|GT76	1.24e-240	1	351	1	351
CEF85209.1|GT76	6.24e-240	1	427	1	423
QPC72356.1|GT76	1.79e-239	1	427	1	423

PDB Hits     

CVK93883.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.11e-240	1	427	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	3.70e-118	7	427	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	9.98e-87	4	427	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.46e-82	4	427	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.99e-56	12	427	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997948	0.002073

TMHMM  Annotations     

Start	End
13	35
107	129
141	163
191	208
215	237
242	264
401	423