CAZyme Information: CVK93384.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK93384.1
• CAZy Family: GH105
• CAZyme Description: Related to KTR1-mannosyltransferase involved in n-linked and o-linked glycosylation [Source:UniProtKB/TrEMBL;Acc:A0A1L7T440]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		52132.59	4.4900

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000006:125475-127016(-)

Full Sequence      

MAKAPRFTLLWAGALTLLHFTLCVCGSALPSSTDDPLKAALVSLVQENDISAILYSIQQI
EDKFNNRHLYDWVFFSVQDLPNRFKDLTSNATNATCFFEVIPEENWNMPGWTDHSQLSGS
HGIDSDGNPKTFKPIADIRQMKRWSSAPFANEQRLSNYEWFWRVEPGASLSQDIPFDVFR
YMRDNGIAYGYNRAVLGQANLYQLSRVKSFIEKHPELLHEEADITWLIENGAGLTIQSSS
SDDSFEGSDETAHDKNTKNEGEEASWIGGSFATWLSEVYGSSLYPTFDIGSLAFFRSPHH
AAFFHHLDSAGDFQYRRVDDVPVHSLSASLFLPRESVWNFGTKNMQLRTQLNIQPTGVGA
IPDGDQRIVDFENTDSGNSVKHKNDAEEEKKSLHDNWELMTPDVSEQSENPHLISGNTWM
GKDVADEAEGCSFFWFWGHILIGSQGFAGYGWETDFSCLQDD

Enzyme Prediction     

No EC number prediction in CVK93384.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	38	340	8.7e-59	0.9560439560439561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	2.78e-54	34	340	78	342	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	1.40e-47	30	340	36	304	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI60522.1|GT15	0.0	1	462	1	462
CCT64215.1|GT15	0.0	1	462	1	462
QGI91426.1|GT15	0.0	1	462	1	462
QGI77718.1|GT15	0.0	1	462	1	462
QPC78685.1|GT15	5.81e-179	1	461	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BOO_A	1.48e-36	38	331	68	327	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
1S4N_A	3.55e-36	38	340	28	287	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
5A07_A	1.97e-25	35	337	97	371	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27810|KTR1_YEAST	7.05e-42	29	341	63	333	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|Q00310|MNT1_CANAL	1.47e-40	34	340	106	370	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P38130|KTR3_YEAST	1.11e-36	38	340	87	347	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1
sp|P46592|MNT2_CANAL	2.69e-35	35	340	138	401	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|P27809|KRE2_YEAST	9.95e-35	38	340	122	381	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000657	0.999313	CS pos: 28-29. Pr: 0.8678

TMHMM  Annotations     

Start	End
7	29