CAZyme Information: CVK92882.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK92882.1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		85554.66	4.9275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000005:2364260-2366690(-)

Full Sequence      

MGLHLSSAWSTPRGWRLITVTLVALTLLLVVPLHRLSDDSPGVYGHLTNYLSHEGAAYDV
EEGFVANLNETTTNQILNDKEPAEKNPYDTDSPQYTGEKDKEASASAEKPAGAQHPEDDK
KAEDAEDDGAVLEIDHGDSDIPQSADQIHSEVPKETTKPESSEIESQAVQSGEPKSQEDG
NKPEETDKEHRPQDNTQPQTGEKKLQADEKASGDEHKPPHSEIKTEESENKHQQGDDKAE
DKDKGDKQPDGTKLSDQSQNNNDHKKEDDDSAAKTQVYQDSATTSIASEFMPSQTADLDV
PSGPLSNWTGVCDGFPNTDGIMLVMKTGATEAFTKLPAHLLTSLQCLDDYLLFSDLDQQI
DKYQIYDVLKDVKDDVKKGRKEFDLYKAQTECPIAQQYCTENMKEGWNLDKYKFLHMVEK
AWEMRPNKEWYVFAEADTYVFWSNLVWYLRNRVNGTETPYVGSVAMLKGKPFAHGGSGYV
IHGDTMRKMVEIPDLAHKYDMMATHECCGDYLMSLAVMETGKKVKQAHPMFNGEKPMTLP
FGNNHWCEPLLSMHHMNPEEVSDAWHFEKTRQKKGFIQIREMYHQFWAPQLEAEHDEWDN
LSDDVCYIGFGPEAQGKATDHQKGRQKKENEKNAIEQHAHRSKEHCAMVCEAENLDISED
DYYNLKDDKERNEMIRSRYSQKKGNKEWHAGRRCFQWRYHNNVCCIARSFKRGKPRKEQK
PEEKWTSGWFVQGINDWIDAKGDCTPKWKD

Enzyme Prediction     

No EC number prediction in CVK92882.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411414	MSCRAMM_ClfB	6.38e-06	79	304	575	813	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
273344	2A1904	6.58e-06	89	289	634	840	K+-dependent Na+/Ca+ exchanger. [Transport and binding proteins, Cations and iron carrying compounds]
227596	MDN1	1.93e-05	61	272	3805	4023	Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis].
226920	CobT2	2.75e-05	97	257	123	306	Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphorib... [Coenzyme transport and metabolism].
273344	2A1904	3.61e-05	83	272	642	852	K+-dependent Na+/Ca+ exchanger. [Transport and binding proteins, Cations and iron carrying compounds]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT68705.1|GT31	0.0	1	750	1	750
QGI95534.1|GT31	0.0	1	750	1	750
QGI81910.1|GT31	0.0	1	750	1	750
QGI64648.1|GT31	0.0	1	750	1	750
QKD54589.1|GT31	0.0	1	750	1	748

PDB Hits     

CVK92882.1 has no PDB hit.

Swiss-Prot Hits     

CVK92882.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000003

TMHMM  Annotations     

There is no transmembrane helices in CVK92882.1.