CAZyme Information: CVK90940.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK90940.1
• CAZy Family: CE16
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7SWP9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
928		100921.27	6.5356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000004:1699963-1703123(-)

Full Sequence      

MAHTDNSDLDPAWQDLDRAIGQILIMGWDGTEVTPQIRSLIEDHHLGSIILTAKNLKSAQ
QTAELVQELQTIAKNAGHLQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRAELA
YEVTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIRD
AGIASCGKHFPSYGNLNFLGSNLDVPIITQTLEELSISALVPFRNAVASGKLDAMFIGGC
GISNPSMNVSHACLSDQVVDELLRDELGFNGVAISECLEMEALSHELGVQNGVIMAVEAG
CDLVLLCRAYDVQLEAIKGLKLGYENGIVTKERVFTSLRRVLNLKSTCTSWEKALNPPGI
SLLSQLHPSHLALSLQAYDDSITIIRDKEKLIPLTASMHPGEELLLLTPLVKPLPASSLT
KKLLAAKDSQNQAEGQHEMWAHNGRDRSAILSGEGVFREFGKSLARARNEKLLHTSYTAN
GVRPVHENLIHRASCIIIVTADANRNLYQAGFTKHVDMMCSMLRTRGQKKQLIVVAVSSP
YDFAMDKSIGTYLCTFDFTENALHALARTLVGEIAPLGTLPGTLRKSKKVLKSRQHWLVE
EYSSKRDASALNDLLRAVHRASAPDLQFLRTTTAASFQLNNANISESHFVVRNSSTNALY
GFAATYFVHGVGILGGVFVEPTKRDVSIGRSLHRRALRSLMQRRGIKQVQIGSAFPGVFL
GIPNDVEVNTIKEWFANSGWDVQFPRRVSNMILQDVASWSAPEGLSQSIQRAGISFDLIH
DLDNADGVLGHVRNNANPEVLELYRHALSESKLSGIVRAKDATGALLGTIIVCKQRSPLE
THIPSLVSRSEDIGGIITPVVPPGPQTTLALQGLTLMGIRQARSHKATKVVLGWVVDDGT
ESLTAMGFETLQEFEEITNSPENFSNII

Enzyme Prediction     

No EC number prediction in CVK90940.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	81	305	5.1e-48	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.98e-67	20	400	7	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.69e-57	16	344	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.40e-35	30	321	10	294	beta-hexosaminidase; Provisional
178629	PLN03080	1.23e-06	105	397	114	418	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT70761.1|GH3	0.0	1	928	59	986
QGI66013.1|GH3	0.0	1	923	59	981
QKD56115.1|GH3	0.0	1	928	59	985
QGI83252.1|GH3	0.0	1	923	59	977
QGI96895.1|GH3	0.0	1	923	59	970

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.82e-92	15	832	8	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.44e-65	16	584	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.42e-39	16	581	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.30e-39	16	581	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.59e-39	16	581	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.24e-38	16	581	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.19e-33	24	324	6	300	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	3.09e-31	23	323	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	5.66e-31	23	323	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|Q9HZK0|NAGZ_PSEAE	8.11e-30	24	321	5	292	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CVK90940.1.