CAZyme Information: CVK90609.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK90609.1
• CAZy Family: GT8
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A1L7SY67]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		89432.12	4.1747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000004:1048938-1051622(+)

Full Sequence      

MSSISFPGGSGLSLGLNGYWGQLGSDSLKSYCDSAPEYVTLSFVNQAPEHTESGYPGTNF
AGHCAAGVYSNKNGVASSLLSECYTIKEGIPYCQERGVKVLLSIGGVYNEAGSNYKVTTD
DKGVDFADFLYKAFGPYDQSWDGPRPFDSDDGTTRPAVDGFDFDIEHDLPNGPYIAMINE
LRRLNSDVIITGAPQCPTSNQYFYMKDMINQAKFDALFIQFYNNPGCDDIPDPSVSWDRF
NYDDWEGIVENSACSQNAKLYVGLPASEAAAPGGGYLEPEAMKDLVCALKDKTHFAGISL
WDLTRGAGNEIDGKNYNEHVMDALKYGCDPVPVTTTTALTTTSEASSTAELTTTADTTTA
DVSTTAGVTTTSGASSSDVSYTDVSSTGASSTETATTSGLTTADTTTASGVSSTEDSTAS
SDTSAATDVTSTLATSAPSDASSATETTDGSATNVSGSVTDTTASESSVTATDSSADTTE
TSATGSVLSTGTASATVDVTATSDSSAITQDAATATSTTDAVLESNTITGTAKTTDSAQE
TESATAETTFSTFKGWNATYGAPSYTQKYGNPTTLIPSGTATITKGSPVYTKYPDNTYAV
SMTTSTVCTTRVHTAVDGYVVTETIPLYTTVCPVTGKAKPTNYAVPSQYETKTVYTTRIQ
TGTKCPPEVADCPYGSVTTETIPVYTTVCPVTEKSKHAPTDVPYNHGIKTLYTSRVNTVS
QCAPGTPDCVIGAITTEIASWTTATMPAQQTQPIKIYKPVSEIPKIATKEAHYNGTVYTS
VAVPPVTLKTAAKPGVFEQAKPTHQQSSGAAAPTGGYTSVPVSAPTYAPAPITPATAGAS
SLAVGLTLMAGMVLFQALAL

Enzyme Prediction     

No EC number prediction in CVK90609.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	3.00e-95	15	322	2	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	3.50e-10	18	315	4	274	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	1.95e-08	86	299	62	279	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
411418	ser_rich_anae_1	3.49e-08	343	549	292	502	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.
411418	ser_rich_anae_1	5.97e-07	343	562	254	470	serine-rich protein. This serine-rich protein belongs to a family with large size (over 1000 amino acids), which a highly serine-rich central region that averages over 300 aa in length. Species encoding members of this family of proteins tend to be anaerobic bacteria, including Gram-positive bacteria of the human gut microbiome and Chloroflexi from marine sediments.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69979.1|GH18	0.0	1	860	1	850
QGI96702.1|GH18	0.0	1	860	1	850
QGI65821.1|GH18	0.0	1	860	1	850
QGI83062.1|GH18	0.0	1	860	1	850
QKD55908.1|GH18	0.0	1	855	1	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	2.52e-61	19	324	6	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	2.59e-61	19	324	7	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	2.59e-61	19	324	7	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	4.85e-37	19	324	11	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	3.03e-28	19	302	6	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	6.09e-59	19	338	34	348	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	3.92e-58	19	338	34	348	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	3.83e-51	19	332	33	343	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|P54197|CHI2_COCP7	1.04e-50	19	336	34	348	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q1EAR5|CHI2_COCIM	1.36e-50	19	336	34	348	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999194	0.000832

TMHMM  Annotations     

There is no transmembrane helices in CVK90609.1.