CAZyme Information: CVK90314.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK90314.1
• CAZy Family: CE1
• CAZyme Description: Related to alpha-1,3-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A1L7SV98]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	FCQH01000004|CGC4	50874.63	5.5287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000004:492362-493768(+)

Full Sequence      

MYRRFIAPLLAVFCFLLVVTSLYLGRDHLTWRSVSYTPVQKGEVDNSSSLKSTTSVTTTR
AKIQESPSHTPTPTTTSAPTPTISNGTILSAERISPYIAAILDPLSTVLPRLECPVLNEN
RYKILQESRHGDEVGDSQINYFFALNLRNCIGILPRLIGSIVEAVRFLGPDRCALSIIEG
NSPDGTSDVLSALKPFLEDSGLVYFYNSSKINPAQRNARIHKLAQLRNLALTPLYKEQVK
ATDDTTVLFINDVSACTEDILELALQRRSLNADMACAMDWTYVGPDPTFYDIWIARTIAG
DSFFEVGSDGNWNSAWNLFWNTPGTRSRYDAQQPFQVFACWNGATAFTAAPLLHGLRFRD
TRKGECFQGEPQLFCKDMWSRGFRKIAVVPSVNLEYSDEKASDIKKLKGYVSDIVERQEE
DGAIDWTYDPPEQVRCMPTWDKQSWRAWNETL

Enzyme Prediction     

No EC number prediction in CVK90314.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	141	379	2.3e-70	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	3.08e-98	141	374	2	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI82899.1|GT69	2.04e-307	1	452	1	452
QGI96533.1|GT69	2.04e-307	1	452	1	452
CCT69815.1|GT69	2.04e-307	1	452	1	452
QGI65652.1|GT69	2.04e-307	1	452	1	452
QKD55730.1|GT69	7.00e-280	1	452	7	459

PDB Hits     

CVK90314.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	7.14e-57	119	451	115	458	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.901716	0.098299

TMHMM  Annotations     

Start	End
5	24