CAZyme Information: CVK87345.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK87345.1
• CAZy Family: AA9
• CAZyme Description: Related to glucosidase II, alpha subunit [Source:UniProtKB/TrEMBL;Acc:A0A1L7STZ1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
963	FCQH01000002|CGC25	109528.26	6.0670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000002:3323251-3326192(-)

Full Sequence      

MKSNTASSFRWTALLLLLSTFTCLFESAIAVKDKDFKKCDQSGFCKRNRAYADNAVAQGS
NWKAPYEISADSTVFEEGKLQAVVVKTINSHGETVRLPLTISFFKSGAARVTMDEEKRRN
KDVILRDDSPVRKERYNEADNWVLVGGLDLDKEAQLAFQDKSQINIKYGPEAKQEAIIKF
SPFEIDFRRDGNSHVKFNDRGLLNMEHWRPKIENKEGEEAAEDESTWWDESFGGNTDTKP
RGPESVALDITFHGYEHVFGIPEHTGPLSLKQTRGGDGNYDEPYRMYNADVFEYILDSPM
TLYGSIPFMQAHRKGSSVGVFWFNVAETWVDITKAKNQMNPLSLGVGGKTSTHTHWISEA
GLLDVFVLLGPTPQDLTKTYGELTGYTAMPQEFAIAYHQCRWNYISSDDVRNVDRNMDKH
KIPYDVIWLDLEYTDDRKYFTWEPHSFPDPIDMGEHLDAHGRQLVVLLDPHIKKTENYPA
SEELVAQDLGVHDKEQKLYEGWCWPGASNWIDCFNPKAIEWWKTMLKFDKFKGTMSNTWM
WNDMSEPSVFNGPEVTMPKDNIHHGGWEHRDVHNLNGLTFQNATFQALLHREKGELRRPF
ILTRAFYAGSQKLGAMWTGDNQADWGHLATSIPMTINQGISGFPFAGADVGGFFGNPEKD
LLVRWYQTGIWYPFFRAHAHIDARRREPYLLGEHYTPIATAAIRLRYSLLPAWYTAFYNA
AQDGSPIIRPMFWTHPSEEAGFALEDQFFVGSTGLLVKPVTEQNKESVDIWIPDDEVYYD
YFTYDVQKTSKGKYLAVSAPLDKIPVLLRGGHIIPRRDIPRRSSALMRFDDYTLVVSASK
AGTAEGELYVDDGDSFDYEQGQYIHRKFTLSGNTLTSIEAEGRDTKSIKSGPWLKAMEKV
HVDKVIIVGAPKTWDQKEVQVESEGRTWTAKVQYHAAKGSRAAFAVVGRVGAKIGEDWSI
KLA

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	366	814	2.8e-146	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	385	855	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	366	814	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	2.24e-175	125	877	39	731	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	5.05e-127	385	724	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	3.15e-105	371	925	164	691	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI80194.1|GH31	0.0	1	963	1	963
CCT66990.1|GH31	0.0	1	963	1	963
QGI63025.1|GH31	0.0	1	963	1	963
QGI93911.1|GH31	0.0	1	963	1	963
QKD50095.1|GH31	0.0	1	963	1	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKZ_A	0.0	31	960	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKX_A	0.0	31	960	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	3.05e-246	13	962	11	942	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	1.26e-245	31	962	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.30e-245	31	962	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	7.45e-280	24	932	19	909	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q94502|GANAB_DICDI	4.69e-250	10	912	2	900	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|B9F676|GLU2A_ORYSJ	1.97e-245	27	963	25	919	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q8BHN3|GANAB_MOUSE	2.21e-245	29	962	31	943	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|P79403|GANAB_PIG	2.49e-244	11	962	15	943	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999725	CS pos: 30-31. Pr: 0.9697

TMHMM  Annotations     

Start	End
7	29