CAZyme Information: CVK86007.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK86007.1
• CAZy Family: AA7
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7SU84]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	FCQH01000002|CGC17	26465.87	10.1345

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000002:598276-599010(-)

Full Sequence      

MHSPIWKFFTFLAVLTATPISPAVALPNIRVLPLGDSITKGTGSTGLVGYRLPLRQKILK
QGVKVNMVGTLKNGNMVDGHHEGHSGKMLADINGYWQKPIQARPNVVLIHAGTNNMDQGK
DLDIAASILADIVDGIFKVAPDVTICLAPVIWANDKKMQANTDKFNPQVRSLISARQKKG
KHILEVPIDIKKEDLGDSKHPNDDGYEKMANAWLKAILAADKKGWLKMPVKMSPEDAPGT
GLGA

Enzyme Prediction     

No EC number prediction in CVK86007.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	29	217	1.4e-50	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.01e-49	29	217	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.57e-15	34	208	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	9.68e-12	31	216	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	1.26e-08	34	216	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
238865	sialate_O-acetylesterase_like1	6.80e-08	29	217	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI70576.1|CE3	8.73e-138	7	244	7	244
QPC62878.1|CE3	9.14e-137	1	244	1	241
QKD61617.1|CE3	4.21e-136	1	223	536	758
CCT63634.1|CE3	2.69e-87	10	243	11	246
QKD52243.1|CE3	6.57e-87	20	243	20	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.01e-16	25	215	2	193	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.34e-11	12	227	25	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999671	CS pos: 25-26. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in CVK86007.1.