CAZyme Information: CVK85955.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK85955.1
• CAZy Family: AA7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A1L7SHY2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		91584.49	6.9353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000002:523498-526159(+)

Full Sequence      

MHILQRQPIDVESTLASLTLAEKISLLSGSDFWHSQAIPSHGISSVKCTDGPNGARGGRF
FNPVPALCIPCGTGLGATWNPDLLYSAGQLLSRECDAKGAHVWLGPTVNLVRGPLNGRGF
ESFSEDPHLSGMLATAIIRGVQSRGTAAALKHFVANDQETAKMSTDICMSERALREVYLK
PFQMAVRDAKPKIVMSSYNKVNGVHVSESTKLLKDILRSDWGFDGLVMSDWYGTYGCTDA
LNAGVDIEMPGPSRHRAEKALVAVVSGKVSRKTIDERARKVLELVNSTASARVLKKESTR
DSPEDRALNRKLATESIVLLKNSDNILPINPADCEDVAIIGPNAKLAAACGGGSANLRPY
YTSSVFQGISDQLPSNTKVHFEPGVFGHVLLPYFTGDHVTNENGKPGASISFFNEPESAW
QTRKPFDHQSIPDTTYQLMDYDHPEKGEKFYMSMTAYYKPDIEGTYEFGLASYGVSRLYI
DEHLVIDNTTSQTHAGMFFGHGSREERGTYEMKASQTYRLRVEAGSASTSITTGGSFIPI
PGGACRLGGCLKLDPEEGIRRAVTAAKKCKHTFVVVGLNADLEKEGKDRESMSLPPHVDD
LVSAVLEVQPNAIVVTQAGNPIEMPWRHKARAILHSWYGGNEAGNAVADIIFGRANPSGK
LPITFPSKLQDGPTFLSFGNDNGRTYYSEDVFVGHRWFDARGIEPAFEFGHGLSFTTFST
YNIRVADDGVRVEVKNTGKMAGAEVVMLYVSYDAIKSGQKSRFHRPVRTLVGFQKVFLEP
GHEATAFMPLDKYSTAVWDVTANSWFCESGAYIASVRSSSGNLEVSFKVEKDMYWNGA

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	250	4.4e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.22e-73	31	379	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.36e-72	70	799	121	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.84e-47	70	284	89	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	5.66e-46	546	694	68	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.79e-44	8	776	50	728	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61585.1|GH3	0.0	1	838	1	838
CEI63709.1|GH3	0.0	1	838	1	837
UPK92689.1|GH3	0.0	1	837	1	838
UQC86128.1|GH3	0.0	6	837	434	1236
ABF50857.1|GH3	3.66e-278	10	837	12	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.05e-220	10	837	5	844	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.08e-214	10	837	5	844	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.78e-136	9	823	3	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.52e-114	18	823	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.41e-95	11	825	4	707	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	6.50e-279	10	837	12	837	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.77e-264	11	837	14	863	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1DPG0|BGLH_NEOFI	2.84e-262	10	837	6	828	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	1.62e-261	10	837	6	828	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	1.62e-261	10	837	6	828	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999421	0.000603

TMHMM  Annotations     

There is no transmembrane helices in CVK85955.1.