CAZyme Information: CVK85931.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK85931.1
• CAZy Family: AA7
• CAZyme Description: Probable GPI anchored protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7SHE1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	FCQH01000002|CGC32	59105.14	7.8902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000002:497003-498835(-)

Full Sequence      

MKFSLTPVLAALALSLPLAAASPQYSNPKAPSCRFGLEWSQKDVLQHTDDFIWDLLYWEG
KFHQNDVAYNTQNGMSYDGTQLDWKTGKRTNKHTFSAASKEALQIMLYAQAISGSKEAAR
FLTPDNLKAAPGFAASIMETKLKTYTQFNQTYPGFGGFLPWIKTDTTTISPQDGWDDRVP
GLDNGELIWAVYACIEALQKQSNPKFHKIADGWQTWFNYVASTAPKIFYIGKGKVCAVTA
IGDQTLPVNDKKQSYKCESETYLDDPYEGELLTYFFQFFTNLSKKDKQTLWEYKRAKLEK
AEYNKGGVGPITVRKGFWFSSHEIWNQLELPYHDVDIVSRLFKNGERARTCNSVVTKTPG
LYASVNNSTDPETDQIIGYISPAGIPSIASQKDQELDVITPYGVFPVVLFDKAVGMAWWR
NMIIGKKMQNPYGSTESTRVDGKGVSALVTWDSKVTTVLSLMNGVVDLVRQRMKSDGIYN
EFLKITEREHVRVFGNNLKGEDIEFCLPKNKVPDAGLKDFTSCQK

Enzyme Prediction     

EC	3.2.1.71:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH162	32	523	4.3e-210	0.9958677685950413

CDD Domains     

CVK85931.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61572.1|GH162	0.0	1	525	1	506
QPC73588.1|GH162	0.0	1	525	1	523
CZS73213.1|GH162	0.0	1	525	1	523
SCB65247.1|GH162	0.0	1	525	1	523
QPC64695.1|GH162	0.0	1	525	1	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IMU_A	2.00e-240	31	523	13	504	The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMU_B The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMV_A The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus],6IMV_B The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus]
6IMW_A	5.70e-240	31	523	13	504	The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus],6IMW_B The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus]

Swiss-Prot Hits     

CVK85931.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000179	0.999803	CS pos: 21-22. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in CVK85931.1.