CAZyme Information: CVK85669.1

Basic Information

• Species: Fusarium mangiferae
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium mangiferae
• CAZyme ID: CVK85669.1
• CAZy Family: AA4
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A1L7SGL6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
968		107300.60	6.4620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FmangiferaeMRC7560	16149	N/A	345	15804

• Gene Location: location=FCQH01000002:115397-118818(-)

Full Sequence      

MTSEKSPMASEKSASRFIESGVLQPPSPTTDAATLKRLEAGDHGAVKTSEYPTRKSPPSR
SAHSSYSGTPAAMQIPDAAAADLPVVARYIARRATLLGWFDEPAATAITSGWSSTCIALK
KPDGTYIYNPDDPSPDLAAAVNRLNESAIVSMASEVTNSVLDSIKPGQASLVNEDTGARI
PIIPSLADVHETLVHLTSSCIVVQERCVLIWAHEARTVLTVAHNVEKQMLGFIVGPNMPR
GLLAQTEEQSVNGMPTPVRGAIDERNEVYQAAIKVEEGGEGDEDVEGQELKRPTLLVHSF
RIGIVIMLVILTQSVGVSRLIRQWSWDGDFTRFALVAVIPPLCVLSLFFFIVVVSSVFQL
LLPAGICLRNSKFHSAIKPNPKRYRDYQLPHITVQMPVYKEGLRGVIVPTMVSVMAAIQH
YENQGGTASVYINDDGMQCIQPELAAARKQYYRENGIGYCARLPNKKSPKSKSFLSWFKR
SPPVDPEVDNQDESEVSPQGRANELGFVRKGKFKKASNMNYCLAFSNRVEDEMLRLTKLE
CESRGCAYEDLSAEDDDRLYDQALQNMVDADEGKTWAEGNIRMGEIILLIDCDTRVPIDC
LLYGALEMYESPEVAILQHGSGVMQVAHNIFENGITYFTDIVYTAIKYGVGTGDVAPFVG
HNAFLRWKAIQSVAFVDPSDKVTKWWSDSHVSEDFDISLRVQMAGMVCRLATYHNGGFQE
GVSLTVYDELNRWEKYAYGCNELVFHPFYKWPYKGPVTRLFLRFLWSNMPVTSKVSILAY
IFTYYAIAAGMLLTLVNYVLVGLFFQDLDQFYTPSWGIWVSLLVVFNGVASIATSMTRHR
LKEKSFWVAILEACKWLPFLLLFFGGISINCAKALLCHAFSVNIEWASTSKELGPTGIYI
GLNKMMHRFKWTFLICIVLAAGMMYMAFGAPWGWTIAPGKFSAGTYAIVPLAVQVSCAFA
LPLFLGLT

Enzyme Prediction     

No EC number prediction in CVK85669.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	586	799	3.7e-52	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.38e-52	586	793	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.29e-09	584	886	138	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.48e-05	584	694	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	9.37e-05	576	781	69	281	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61408.1|GT0	0.0	1	968	1	968
QPC62761.1|GT0	0.0	8	968	1	973
QPC80132.1|GT0	0.0	8	968	1	973
SCB65002.1|GT0	0.0	8	968	1	973
CEI70391.1|GT0	0.0	8	968	1	975

PDB Hits     

CVK85669.1 has no PDB hit.

Swiss-Prot Hits     

CVK85669.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

Start	End
299	321
333	355
781	803
815	837
847	869
913	935
945	967