CAZyme Information: CTRG_06095-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_06095-t43_1-p1
• CAZy Family: GT91
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		63119.57	4.4600

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692405:298710-300386(-)

Full Sequence      

MQKSVFYFLLLFLKLVFADYTDDEDDEDNESEFETDQSDYEIKRCNPYKDANCLVSNEAL
GRKVFESFSDGTKYFTITSSRRGVRFDEDGLTLTILDKFDNPALASSFYIMYGKIDVEIK
GAPGKGIISSFYLQSDDLDEIDVVEIFGSDPYEFQTNFFIKGNVSNYDRGKYHQMHPSPL
SGYHKYSVEWTPDLITWFLNDKPVRMLGRKNRHGMPCSPMFLKFSLWSADENDEGTIAWA
GGVASFSEGPFSMHIKNLEVHDYSNGISYNYGHLRNGKWLDLSSEGGEIYEGHKFCTPPT
ELEQPAEKKKKWPDSRYIKPTVLPSKPSAVEKPASATKQPYTKPIKEWENFDDDRDEEEE
GSAEEDNWGHTPDEIIDGEHNDYEQEEDDDEAHDEDTKSGEKNVGNADKEDGYDETNEGE
TQDEEKTTTIPAANLLKRPVKKKQELAGSEDKGRENPSDGLSKKTKKGRNKKMKSNSLIS
STIVSEHSSTLNSNSSVTTESESILSTSTSKARLPYNIFFQYPDRDNSIIKSGVSNQISG
SLLSVVFVEALIVMTLLV

Enzyme Prediction     

EC	2.4.1.-:3	3.2.1.39:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	89	242	3e-55	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.47e-90	73	264	10	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	6.89e-44	84	241	6	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	2.10e-23	65	255	3	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185685	GH16_XET	1.03e-21	67	261	5	201	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185684	GH16_lichenase	6.50e-20	75	241	25	193	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW29885.1|GH16_18	2.43e-167	1	557	1	503
AAV02850.1|GH16_18	4.10e-166	1	557	23	525
CAX41820.1|GH16_18	2.82e-157	1	557	1	520
CCG24345.1|GH16_18	7.57e-105	38	291	52	307
CCE40070.1|GH16_18	5.43e-102	22	289	39	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	9.33e-41	90	282	48	242	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	4.11e-14	73	260	15	201	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
2UWC_A	3.76e-13	85	229	33	187	Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus],2UWC_B Crystal structure of Nasturtium xyloglucan hydrolase isoform NXG2 [Tropaeolum majus]
2UWA_A	7.09e-13	85	229	36	190	Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_B Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus],2UWA_C Crystal structure of the Nasturtium seedling xyloglucanase isoform NXG1 [Tropaeolum majus]
2UWB_A	1.17e-12	85	229	34	183	Crystal structure of the Nasturtium seedling mutant xyloglucanase isoform NXG1-delta-YNIIG [Tropaeolum majus],2UWB_B Crystal structure of the Nasturtium seedling mutant xyloglucanase isoform NXG1-delta-YNIIG [Tropaeolum majus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AK54|CRH12_CANAL	4.31e-168	1	557	1	503	Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH12 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	2.77e-68	45	289	24	267	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|P53301|CRH1_YEAST	5.84e-66	45	290	40	283	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|D4ALQ5|CRH11_ARTBC	2.66e-46	45	299	23	273	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	2.45e-39	90	286	69	267	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000184	0.999779	CS pos: 18-19. Pr: 0.9838

TMHMM  Annotations     

There is no transmembrane helices in CTRG_06095-t43_1-p1.