CAZyme Information: CTRG_04730-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_04730-t43_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		48072.92	9.8586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692400:1013941-1015170(+)

Full Sequence      

MNLFGKLLRLFVLFKGIQLILVYFTPCQFDTSSQIIINNLSSSSYNSIITNILNKLIVWD
SVYFNDLFINPIRFEHQFVFCPGWIKFIKIFGQNKDINYYRFQLLSVLLSNIFHFISLII
LYYLTNEIYGNGNGNGKLSYYSSLLMIISPAGIFLTTNYSENFSNLLILLTIFIYFKAIN
FNDVKQFSNKSIRSKSLYVLSGIICSIGFTVRANSLFLGILYLLDLYHFLQNMKRNRKQG
IIEIVYSLITGSLLFFTFLGTNLYHYMKFCPNRGEWCNKMFPSLFQYAQDHYWNVGFLKY
WTINNIPNFLLVLPVLSFNIYSIIYMIQYLPKYRKLLPIIIINGLTLIGGIFFWNIQILN
RITSFSPLIYWTLADNLVKKKYWVKYVIYYSIMWSLIQTVLFAGFLPPA

Enzyme Prediction     

No EC number prediction in CTRG_04730-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	8	409	4.4e-101	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.59e-41	7	409	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.45e-19	102	409	115	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW26102.1|GT76	1.14e-181	6	409	4	394
CAX44663.1|GT76	4.85e-181	6	409	77	485
CCG22525.1|GT76	1.09e-164	6	409	39	432
CCE40664.1|GT76	2.50e-158	6	409	8	401
ABN67789.1|GT76	3.43e-124	5	409	7	394

PDB Hits     

CTRG_04730-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VN0|GPI18_CANAL	2.02e-182	6	409	4	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	2.12e-104	7	409	7	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|P38211|GPI18_YEAST	2.46e-60	11	409	9	433	GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI18 PE=1 SV=2
sp|Q6C216|GPI18_YARLI	1.18e-53	4	409	4	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	3.00e-50	15	409	21	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.819566	0.180436

TMHMM  Annotations     

Start	End
7	24
103	125
138	157
162	181
202	224
244	266
309	331
336	358
386	408