CAZyme Information: CTRG_04635-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_04635-t43_1-p1
• CAZy Family: GT33
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	GG692400|CGC3	74252.91	4.8799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692400:801854-803830(+)

Full Sequence      

MKMKKKKAAEKSVRYKFSICNFSFFLFSNTISTNQNMHLSILTLLLVFLQPIKGESNTST
ILGIPTTQEDEDLSGSQSISPIRVVGNKFFECENGQQFFIKGIAYQKSRQEGEIYDATKE
PHYVDPLANPFTCLRDLEYLKELGVNVIRVYQINPNANHDVCMNAFAEAGIYVLADLSEP
YMSIRRDYPHWDTELFNRYKEVIDAMNKYNNMLGFFAGNEVANAQSNIDSSPFVRAALRD
CKKYIDEQGYRKIPIGYASNDDASIRKNLANYFVCKLDEDEDNYSRADFFAINVYEWCGY
STYTTSGYRDLTVAFNNYPVPVFFSEFGCNIITPRPFTEIEAIYGTTMRKVWSGGIVYEY
FEEVNHYGVLLSKKDGSISKLPDFDTLKMRYNSVTPIGITVDEATICEPKSCIQPEDDAW
DIALSLPPTPDQGKCECLWQSLSCVIASDAQFDEEVALKDLCFKVDCEDINANGRLGKYG
KYSDCNPTVRASYALNKHYEQSGRKQDICDFQGRGQLSSGRGLDDLGSKYSSDGRNCLAI
IEGRAQPDCQPGQGGGKDNDGKEYDHGKGDHEYGKEYDDGDDYDDYDDDDDDDGRDYGDD
RKGSKDSSGSRRKSHKKPHNKKAKAKPTKSVTSGSTTYKNSIFQTIVKLLFTCCALLI

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	77	393	7.2e-130	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.25e-154	78	394	8	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	2.89e-20	442	515	1	75	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.40e-10	442	519	1	75	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABU33902.1|CBM43|GH72	9.98e-289	79	546	52	537
AOW25920.1|CBM43|GH72	2.01e-288	79	546	52	537
CAX44480.1|CBM43|GH72	3.37e-286	70	546	45	547
CCG22464.1|CBM43|GH72	2.57e-255	59	542	12	486
CCE40599.1|CBM43|GH72	3.77e-254	70	541	6	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	9.62e-150	35	509	5	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	2.71e-149	35	509	5	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	2.71e-149	35	509	5	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VW6|PGA5_CANAL	3.57e-289	79	546	52	537	1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA5 PE=1 SV=2
sp|Q06135|GAS2_YEAST	4.95e-149	35	509	5	466	1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS2 PE=1 SV=1
sp|O74137|EPD2_CANMA	3.27e-139	81	518	28	465	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1
sp|O13318|PHR2_CANAL	2.21e-138	76	548	22	483	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|P56092|EPD1_CANMA	3.66e-138	74	548	20	483	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.802147	0.197858

TMHMM  Annotations     

There is no transmembrane helices in CTRG_04635-t43_1-p1.