CAZyme Information: CTRG_02923-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_02923-t43_1-p1
• CAZy Family: GH81
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	GG692397|CGC12	70103.53	8.0275

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692397:1980024-1981838(-)

Full Sequence      

MYFIIFVVSVVYLTYKLFTAVLPHHLLVPSQSWKEKITKVIEYPKPIYLEVGTKRSSYRR
RLILASKNPSFYTNFRNNKLKINPEDSKDGENFLNEMRRRDAHDPKRRVIYGFFHPYANN
GGGGERVLWQAIKATLLADDKNICAIYTTNIEAEPLDILNKAENKFQIDGLDHSRIVFIY
LRRFNRLIDGAYWKHFTLIGQLFGTALLTFEAIFELAPDVWIDTQGLPSSYLLVSTSLKI
PIMAYTHYPILQSDMFGKLKFQRFADLKKFSIIRVRDYLSFGKLVYWSLLYYFYVFLGTK
VNIALANGSWTYEHLTRIWTFNPAFGHKLEILYPPCGTEYLTANIDVTKPRENKMLYLAQ
FRSEKRHDLLLSEYGSFLKKNYPGVTKPTEEIPTIVYAGSCRTADDTATLKSLQKQVDDL
ELTEFVTFRVDISYDEVVELLSTCKFGLNAMWNEHFGIGVVEYMARGCIPIVHASAGPLL
DIVGNDQLDNWNSETGFFFKSYNDPDLDKSLQEKVINGFVAYELNGHIINYPTFASLLTE
IFVVDRSFISDAKLIKMRQNDQQLVKQKFSNKTFNESWISYINELDAMEKDFREENRSNV
EKVF

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	348	512	8.9e-20	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	109	506	1	383	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
406369	ALG11_N	5.92e-99	109	319	1	208	ALG11 mannosyltransferase N-terminus.
215511	PLN02949	3.80e-87	93	497	25	404	transferase, transferring glycosyl groups
395425	Glycos_transf_1	1.78e-14	352	507	2	134	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340834	GT4_ALG2-like	3.64e-10	330	577	182	391	alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30162.1|GT4	0.0	1	604	1	609
CCG24455.1|GT4	3.63e-271	1	604	23	626
ABN66374.1|GT4	1.48e-265	10	604	2	606
CCE39710.1|GT4	3.21e-264	1	604	1	604
CAG85902.2|GT4	1.07e-243	7	604	10	616

PDB Hits     

CTRG_02923-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59S72|ALG11_CANAL	0.0	1	604	1	609	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG11 PE=3 SV=2
sp|Q6BVB2|ALG11_DEBHA	1.90e-244	7	604	10	616	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG11 PE=3 SV=2
sp|Q6CLD6|ALG11_KLULA	4.09e-118	49	586	60	562	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG11 PE=3 SV=1
sp|Q6FWD1|ALG11_CANGA	5.28e-103	111	586	48	496	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG11 PE=3 SV=1
sp|Q75B12|ALG11_ASHGO	8.51e-103	26	582	41	566	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997780	0.002242

TMHMM  Annotations     

Start	End
4	26
192	214
229	251
284	306