CAZyme Information: CTRG_02572-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_02572-t43_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1451		167763.38	4.7865

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692397:1161040-1165395(+)

Full Sequence      

MMSMKCISTFLAFCLLSTTVNAFLNNNLSIQLDAPWQKIDFLPSLIETVASYNSSLYYTT
IETIFGLDDSDNDFDEDSSDKNIYEQICKNLDKYTKSFVDFDLINKKHGARVVSHYDHYQ
QVLSRMGDRLQKECEYDSFGNEVKKKNGQLQTWLLYNDKIYCSANDLFALRTDTSKEKTL
LFDRVFGDNEEAPLLVLYGNPVEESTKEFFKVLYPDAMAGKIRFVWRYIPTFRKRQDTLP
GYGVSLNMKNYDYGNGEKTSNFDLNKDLHKINDSGILIPVPEKNRDELGIKFTSFILSNR
YKIHKYELLSTLLNDFPKFIPYIAKLSKSFNYEKVKTKVTANQDIGMSDESYGIYINGSP
IHGLELDIYKLGNKIREELETIQNLVKLGFDSIQAKLLLTKFALLSAVKQTQFRNGNTLM
GNNENRFKVYQSEFEKGNPGKGGVLFFNNIEVDVTFSEYTTNREEAYLGVSSYKLKPNQI
PPLKENIHDLIFALNLANKSQLRVFFTIAKVILDSGIPQQIGLIPVIGDDPLDKEIARKF
YYIAENSNTPEALALLYKYFDSANSDEAAAILNQVKVSKNFDVDYNYVLDKFSITEASVI
FNGVIYDLRSPNWQIAMSKQISQDVSLIKSFLRQGPVEGKLKDKLYSNAKEKRNLRVIPL
EPSEIIYKSVDTELLNESIAFKKIDKEDGVSGTFWLVSDFTKVEMFNQLIDLLSFLKKKP
IQVRVVNTGDSKVFKSLHKNYKLTTLTNSQIEEIIEVLEDAELSKYDNPEVKRLLERKHL
PSHHSFMLFNSRYFRLDIPLEPTELEELLEYEFTQRLNLFNDILYAYPDEFESKKLNEFN
SLVSGLDSMDWFDLVSSIVTKSFHVDEKMFISDVNRFDFSSLDLSNSIDVSVNKEENPID
ILVIMNPMEEYSQKLLSIVNSIKTFPFVNIRILLQPKVVSNEEIRVHRFYRGVYPSSDIQ
FDENTGIVVENNIAEFHNLPVDTRLSTELDVPTKWIVVSKSSSTDLDNVAFNKVVKSVNG
KFLLKHILIEGFARDIHTGRTPDGLSFKLVHNNITTDTQVMSSLDYFQLKAIPGISLLSS
NPEYNLLSASENKYDFNHDSLDEVEVPVFSLDGVTLYPRISKGDGITKYSNRHADINIFT
IAGGSLYEKLASIMIASVRKNNPESIIKFWILENYITPEFRQLMQLISKKYTVQYEFINY
KWPKFLRNQKSKERTIWGYKILFLDVLFPQDLDNVIFIDADQTCRSDLTELVNMDLQGAP
YGFTPMCDSRKEMEGFRFWKQGYWSDVLKDDLQYHISALYVVDLKQFRSIKAGDRLRAHY
QKLSSDPNSLSNLDQDLPNNMQRQIKIFSLPQNWLWCETWCSDESFRDAKMIDLCNNPLS
KENKLDMAKRLLPEWVEYEKEIDELVSNLKEISSSVEDDENEEMEDDSILFEDTGFDEEE
EEEEEDYHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1136	1385	7.3e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1136	1405	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.04e-142	1136	1385	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	3.28e-46	1136	1378	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	3.59e-29	440	657	9	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	3.73e-28	41	230	4	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC18923.1|GT24|2.4.1.-	0.0	11	1417	11	1423
AOW28327.1|GT24	0.0	11	1417	11	1423
CCG22175.1|GT24	0.0	14	1412	15	1407
CCE40308.1|GT24	0.0	28	1418	41	1423
ABN66217.2|GT24	0.0	26	1411	30	1480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.80e-158	27	1411	10	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.49e-158	27	1411	10	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.61e-158	27	1411	10	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	2.43e-137	27	1411	10	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.17e-124	27	1347	3	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	9.57e-155	138	1402	109	1421	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.71e-134	162	1405	159	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	1.34e-132	151	1405	148	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	6.45e-132	151	1405	148	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	1.59e-131	32	1415	34	1517	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999784	CS pos: 22-23. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in CTRG_02572-t43_1-p1.