CAZyme Information: CTRG_02131-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_02131-t43_1-p1
• CAZy Family: GH38
• CAZyme Description: glycolipid 2-alpha-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		51076.43	6.2034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692397:13945-15228(+)

Full Sequence      

MMLSSRSPYLKYLAVLLTVVTIYVLTHHSTTITSSLPTQQQQQQQQQPSQAQPPQVENVK
VPEELKTEPEQKDQKNEEVKAEVEQESTSKAVKPKESTPEEKPKRIKATFVTLARNEELY
DLIKSIRTVEDRFNRKFNYDWVFLNDKEFTQEFKDLTSSIVSGKTKYGKIPTEHWSYPDF
IDLKKAEETRKNMKLAKIIYGDSESYRHMCRFESGFFWRNELLDEYDWYWRVEPGIDIHC
DLDYDLFKYMEDNNKVYGFTISIHEFRKTIETLWDHTKKFIKENPQYIAKDNFMDFISDD
NGETYNLCHFWSNFEIANLNFWRGEAYTKYFEYLDKTGGFFYERWGDAPIHSIAASLFLP
KDKIHYFEDVGYRHGVYTQCPLNSQFRYDHKCHCNPDKDFTFRGYSCGKKYYEKMGLEKP
KEWVDYQ

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	105	374	5.6e-131	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	1.80e-180	104	423	79	398	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	8.89e-153	70	374	3	311	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX42700.1|GT15	1.76e-236	4	427	8	458
AOW28224.1|GT15	9.26e-235	4	427	8	461
CAA61538.1|GT15|2.4.1.131	9.26e-235	4	427	8	461
QWU86097.1|GT15	3.80e-217	105	427	108	430
CCG23499.1|GT15	1.53e-215	4	427	8	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	1.63e-156	107	427	28	347	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	2.99e-99	105	417	66	385	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	2.49e-86	105	381	102	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46592|MNT2_CANAL	1.64e-235	4	427	8	461	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|Q00310|MNT1_CANAL	7.84e-167	105	426	108	429	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P27810|KTR1_YEAST	2.02e-155	89	426	59	391	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|P27809|KRE2_YEAST	2.18e-154	107	427	122	441	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1
sp|P38130|KTR3_YEAST	1.94e-138	99	420	79	401	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999466	0.000546

TMHMM  Annotations     

There is no transmembrane helices in CTRG_02131-t43_1-p1.