CAZyme Information: CTRG_02090-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_02090-t43_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	GG692396|CGC1	43958.07	4.3740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692396:2215990-2217153(+)

Full Sequence      

MIFIHLLLMVVFSSFSIGIPVEKRVDTTWNDAFQTTLNAMWSVFWNDQNQGFTFEDPSCP
GATYTDASVWDVAVAGKAITNSGDISRINQVITTLYRYQNEQGWFASHPYGQDVYVDDNA
QVLWVFLDAFKLTQNQQYLTTAINLMHLIQTQWSNAGGIIWQVGDDYVASISTTEAALSA
VKLYEYNSDESLLTFAISCLTWLDEHLTDPSDGFYYDGLDRNNFQVNRGKLTYTVGVAMS
TYAYLYKYSGDLHYVLSAVKKAWASLNSDVFLRSNSYWNNDLKYLHLLFVGFADVISFCG
QAGYIPHITKQGLFIYQYDAIGDGHYMDFTSNLITYDNYINATRDRSIAYEPDNDMYCSN
GSGQLRRNLLNDASAAQIFYEISRVTP

Enzyme Prediction     

No EC number prediction in CTRG_02090-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	266	1.1e-35	0.664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.02e-19	28	271	1	256	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27992.1|GH0	1.01e-161	2	384	4	399
AOW27980.1|GH0	6.76e-143	18	385	34	411
AOW27993.1|GH0	7.63e-131	4	384	4	415
CCG26053.1|GH0	4.40e-117	20	385	17	384
CCE44944.1|GH0	1.69e-114	5	386	2	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.57e-12	46	262	80	286	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.85e-11	46	262	81	287	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	9.05e-11	127	262	146	287	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6U4Z_A	2.08e-10	111	273	226	407	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	2.86e-07	69	245	47	248	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999779	CS pos: 18-19. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in CTRG_02090-t43_1-p1.