CAZyme Information: CTRG_01646-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_01646-t43_1-p1
• CAZy Family: GT91
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		55619.48	7.9760

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692396:1238118-1239509(-)

Full Sequence      

MPRSQSTLKSLLKNWEYKIAIFIAVYFLFSHVLLETTDTVKEKGLKSHLKLLPEEVIEYY
EKQPFPHDVEKYAYMQYATNYDYLNLAIINFIHLRKSGTKIPNLVIIYDNILNFYASDKW
SDLFQVANHYKITLKSAPLIKANYKDETNWAASFTKFHVFNHDEYERIVFFDSDSMLVDI
PEEIDFDNMESKFNNIDELFKIPKEISFALPQAYWLNNVVEGKSAKPKIKVEIPNKKRYS
LRMKKLVNDLQVSQDFNVLPSIIYENHYYDNSNHFFANHIMVLEPSKKTFNELMRYVNNP
WWWYITNRANLRKHSDYDMEILNKYLYNELRNKNVNVGILPHRVYGVLTGEFGEEWHERF
VAEPQYLPFVKKKSNNGWNAIEFFRKIKLVHFSDSPIPKPWEEESNKDHYNTKKIYCAHG
DMEKYNKEYPVYKPRLTADCDSVDIWNWLRNQFYRERQGYWLV

Enzyme Prediction     

No EC number prediction in CTRG_01646-t43_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	9.12e-103	72	453	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	1.46e-23	72	402	1	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133018	GT8_Glycogenin	6.28e-11	72	217	1	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	5.78e-05	71	214	70	202	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27523.1|GT8	1.33e-283	1	463	1	462
AAV04198.1|GT8	2.43e-275	16	463	9	455
CCG21314.1|GT8	1.68e-218	1	461	1	467
CCE43359.1|GT8	4.29e-214	1	461	1	467
ABN66322.2|GT8	4.28e-189	5	463	9	478

PDB Hits     

CTRG_01646-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59ZI3|GNT1_CANAL	2.36e-284	1	463	1	462	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	2.88e-128	14	463	13	464	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q6CT96|GNT1B_KLULA	1.98e-25	66	432	79	443	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	2.97e-24	68	443	151	437	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q12096|GNT1_YEAST	9.37e-21	71	408	91	452	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000003

TMHMM  Annotations     

There is no transmembrane helices in CTRG_01646-t43_1-p1.