CAZyme Information: CTRG_00169-t43_1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTRG_00169-t43_1-p1
• CAZy Family: AA4
• CAZyme Description: glucan 1,3-beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	GG692395|CGC7	33973.82	4.0510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404	6441	294747	187	6254

• Gene Location: location=GG692395:371427-372356(+)

Full Sequence      

MQFKYLAGLLPLFVTAVQGMGDLGFNLGVQNNDGSCKTAEDYKSDLDVIKNYAKVIKIFS
VSNCDTLKILGPVAEEEGFQIQLGVWPDDPNQFNAEKEALSNYLPNISKSTVKIFLVGSE
ALYRKDMTADALADAINEVRDLINDTKDKNGDSYKGVPTGFVESWNVIADGTANAVISAS
DVVYANFFAYWQGSDISNASYVFFDDAMQALQTIQTAKGQTDIEFWVGESGWPTEGQNFG
AAEPSVDNAAEYYQKAICALRAWGIPVSVFEAFDETWKPTTSDTQGVENSWGVWDSSRKL
KYPISCDFS

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	306	4e-45	0.9967845659163987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.18e-82	16	298	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.27e-82	23	306	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28996.1|GH17	1.24e-141	1	309	1	308
CAY05234.1|GH17	3.54e-141	1	309	1	308
CAX42094.1|GH17	1.01e-140	1	308	1	307
CCG23752.1|GH17	4.11e-140	1	308	1	307
AAV05244.1|GH17|3.2.1.-	4.71e-140	1	309	35	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.30e-36	24	307	39	295	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.48e-35	24	307	39	295	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	2.20e-142	1	309	1	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	4.87e-139	1	309	1	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	9.60e-126	12	309	14	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	6.04e-78	21	306	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	1.55e-60	15	306	16	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999715	CS pos: 19-20. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in CTRG_00169-t43_1-p1.