CAZyme Information: CTMYA2_061360.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_061360.t1-p1
• CAZy Family: GT91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603		68898.38	6.6653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047874:923840-925648(-)

Full Sequence      

MPYSPKQQMITQSGVPRLARPLIAVSCLFLLYYLFSNRNSQDSAELVVPQSKIDQMFIQQ
QHGESKQDTTHNPNIFPVDDDFLKKMDIKVKKCPDYVTYSQQKHLPFSEGKYNYPYMRPA
PKCRTFQSEAVEKLIDDLKSKIADPDLSRLVENCLPNTLDTTILWHKNRGGNTPRGDSRV
FPQSFIVTGDIHAEWLRDAARQLSVYQPLIKHDPKLKNLILGAINTQAYYVVDSPYCNAF
HPPPGSGVKKGNTAFDSVFPVPNWKQVFECKYEIDSLASFLTLTNDYFENSNGDLSFIDN
VWIRALEKLLVVLRRESVPSFDEETGQALPFYYSFQRNTNIGSETLPLGGVGNPVNYGTG
LIRSAFRPSDDATILQFFVPGNIHMYTELKRARKNFINNDNIPRDRLIVETVDSFIETLS
VGIEKYGIINHPEFGKVYAYEVDGYGSATFMDDANIPSLLSIPDLGYKPVDDEVYQNTRK
MILSKEGNPYYLKGYYFEGIGGPHIGIKNAWPMSLLMRIRTTDDDEEIMNSLELVMQTTG
QLGLMHESINVNSRNGKDYTRPWFAWCNSEFGKTILHLAKHKPHLIFKKEFHKPYEIDTL
FSL

Enzyme Prediction     

No EC number prediction in CTMYA2_061360.t1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	144	576	1.6e-157	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	144	576	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.29e-154	123	585	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX40772.1|GH125	0.0	9	602	1	607
AOW30603.1|GH125	0.0	9	602	1	614
CCG25178.1|GH125	2.85e-311	8	602	39	646
CCE41065.1|GH125	1.85e-305	9	602	1	610
ABN66980.2|GH125	9.42e-292	92	602	62	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.53e-97	113	579	38	469	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	6.66e-95	118	579	21	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	1.75e-94	113	579	18	449	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	8.83e-86	129	575	10	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.38e-85	129	575	10	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.09e-173	82	588	16	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999487	0.000532

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_061360.t1-p1.