CAZyme Information: CTMYA2_060870.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_060870.t1-p1
• CAZy Family: GT91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		102821.50	6.0335

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047874:829844-832546(+)

Full Sequence      

MDYLTPSTLPQPKLKRTNTGFTPNQIIALDATIPESAKHIWYKYSQLKILDSNKRNGHGD
VDDEHNIKSLVKNPARFEEEFVKHVETSLGRSMYNCDNLAAYQAASNTIRDALLIDWANT
QQRQTIQDGKRVYYLSLEFLMGRAMDNALINLKAEKNTQKSLSDLGFNLEDVLDQEPDAA
LGNGGLGRLAACFVDSLSSKNYSGWGYGLNYQYGIFKQKIIDGYQIETPDYWLNYSNPWV
LDRKEIQIPVDFYGYVYEEHDPNTGKVKKNWNGGERVLAVAADFPIPGYNTENTNNLRLW
NAKPTTEFDFSKFNAGDYQQSVAAQQRAESITSVLYPNDNFERGKELRLKQQYFWVAASL
HDIVRRFKKNHKTNWKKFPDQVAIQLNDTHPTLAVVELQRILVDLEGLEWDEAWSIVTKV
FAYTNHTVMAEALEKWPVDLVGRLLPRHLEIIYDINYFFLKNVEKLYPNDRDLLARVSII
DENPKSVRMAYLAIVGSHKVNGVAELHSELIKTTIFRDFVKVFGEDKFTNVTNGITPRRW
LRQANPKLAALIAEKLDDPNYDYLTNLGKLKKLEAFVDDPEFLKRWDAIKFDNKRRLAAL
VKEETGVDIDPTVLFDVQVKRIHEYKRQQLNIFAVIYRYLHIKQLLKQGVSLDEIKAKYY
IPKASIFGGKAAPGYYMAKTIIHLINKVGDVVNNDPEIGNLLKVVFIPDYNVSKAEIICP
GSDLSNHISTAGTEASGTSNMKFALNGGLIIGTVDGANVEITREIGEENIFLFGNLAESV
EEIRHKHIYDGVKVPEQLQEVFHAIESGMFGSPDEFKALIESIRDHGDYYLVTDDFELFL
EAHKKLENVFGHHGGDDKDTTHMNNWVKKSVLSVANMGFFSSDRCIDEYAENIWNVEPSN
V

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	162	897	3.7e-273	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	109	898	49	812	glycogen phosphorylase; Provisional
223136	GlgP	0.0	72	898	4	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	123	894	52	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	81	896	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	79	896	2	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX40640.1|GT35	0.0	1	901	3	900
BAE44621.1|GT35	0.0	1	901	1	898
AOW30468.1|GT35	0.0	1	901	3	900
ABN66962.2|GT35	0.0	2	900	3	895
CCG25253.1|GT35	0.0	2	901	4	901

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	12	898	1	877	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
1XOI_A	1.33e-263	71	901	21	832	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]
1FA9_A	1.89e-263	71	901	21	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	1.89e-263	71	901	21	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
2QLL_A	1.95e-263	71	901	22	833	Human liver glycogen phosphorylase- GL complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	12	898	24	900	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	1.72e-304	70	901	37	845	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	4.89e-282	70	897	107	908	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|P06737|PYGL_HUMAN	1.00e-262	71	901	22	833	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
sp|P0AC87|PHSG_SHIFL	1.93e-262	109	898	49	812	Glycogen phosphorylase OS=Shigella flexneri OX=623 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_060870.t1-p1.