CAZyme Information: CTMYA2_051640.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_051640.t1-p1
• CAZy Family: GT58
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	CP047872|CGC13	93131.74	4.9153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047872:2202093-2204603(+)

Full Sequence      

MASIDIDKLINELTLDEKISLLAGKDFWHTFPIPSKSIPSLRFSDGPNGIRGTKFFDSVP
SGCFPCGTGLSSTFDKDLLIKAGELMAIEAKHKGSHVILGPTMNIQRGPLGGRGFESFSE
DPYLTGKSASFIVQGIESLGIGSTPKHFICNDLENERNSSDSILTPRAFREIYLEPFRIL
FKDISPSCLMTSYNKVNGVHMSQNKEILEGIVRNEWGWKDGLIMSDWFGTFTSKEALEAG
LDLEMPGPAVFRRNDEIGHMIKTKELNIKVLNERVRNVLTLIKKLSESSGVPENAPEDTD
NNTPETRKLLRKLAQDSIVLLKNEDNLLPLQKDDSIAVIGPNAKAAVYCGGGSASLRAYY
TTNPFDSICEKLSSTPKYTVGCHNHKFLPGLGEQVINPRTGKKGYSMKFYKEPKGTDNRT
LIDDHDLDLSNFHLVDYYNDKAKDGLYYIDFECEFTPDETAEYLFGLTVVGTAQLFIDGK
LVVDNKTKQTKGESFFNCGTIEEQGSMKLIKDKTYKITIEFGSAPTYTLGNKGAEYFGGG
INLGMIKVIDAQKELEHAIELAKSVDKVVLCVGLNGEWEAESYDREHMKLEGLQEELITS
IIKANPNTIIVNQSGTPVEFPQLENYKSLIHCWYGGNEAGNAIADVLFGDVNPNGKLSLT
FPIRGIDNPTYLNFKTERGRVLYGEDIFVGYRYYEKLQRKVAFPFGFGLSYTKFEMKNLQ
VDVVDNGDNVKVSVEVANIGDVAGSEVVQVYVSKLETDVIRPVKELKGFDKVELTPGESK
TVEIVLPIKYSVAFFDEYAEEWSVQSGEYQILVGNSSDNTPLIGSFKVDKDYFWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	246	8.5e-56	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.35e-72	64	820	120	757	beta-glucosidase BglX.
224389	BglX	9.71e-60	33	344	55	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.55e-50	318	691	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.63e-45	9	793	56	751	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.28e-30	64	281	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85284.2|GH3	0.0	1	837	68	904
ABN67130.1|GH3	0.0	5	836	7	838
AOW28223.1|GH3	0.0	3	837	4	866
CDR47499.1|GH3	0.0	2	837	3	839
CDR44766.1|GH3	0.0	1	837	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.18e-311	1	837	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.19e-304	2	837	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.91e-139	3	830	2	670	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.38e-115	10	831	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.21e-96	6	831	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6J6|BGLS_SCHPO	1.81e-312	1	837	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|P07337|BGLS_KLUMA	2.46e-303	1	837	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.25e-302	1	837	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	6.53e-302	1	837	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.18e-299	1	837	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995966	0.004058

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_051640.t1-p1.