CAZyme Information: CTMYA2_040450.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_040450.t1-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	CP047871|CGC2	96136.34	5.3208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047871:1870209-1872674(-)

Full Sequence      

MSNGLQNWEFRTLTNHPNSTLEINKWYNTSPVSRSHQVHVDLLYNDLIPDPFINDYETNL
KWISELNWQYRCIFDSSSSDINETMVLIFEGIDTFATIQLNNETILTTDNAFHKYNVPVN
IQDHNELIITYESSFKKGKILEKKYGKNPVWNGDSSRVYVRKPQYQYGWDWGPILNTFGF
ESVKLISSVNYIDDFFVGYKLNDELDTVELSLELSFLSTPTCLDVKIEIKDNVGDYVGVV
ESQNVEKYTQLGYTLSNVKLWYPIHQGNQSLYTFDVIINGVLKQTKRVGFRKVELIQSDD
ELGRSFYFRINNKPIHILGTNWIPAHSFTSKLTPNDYSQWMELVANGGYNLIRIWGGGQY
ENSQLYELCDELGIMIWQDFMFACGVYPDIIIDSVKKEVHDQLMRLRQYCSIIIYAGNNE
DYQIAEAEKLDTNNVTQFPAKIIYEDVIPSYVTKLCNQTPYHFGSPYSDNTHKSSDPNIG
DLHQWNVWHGDHEAYQNWPQLTGRFVSEFGMLSLPSMRTLNTYIDESQLYPNSTMLDFHT
RAAGREYLDTYVWDNFPKPQILTIESWIYLTQLMQSDALSFAYRYWRRNWLDYKTGGIIV
WQLNDCWPSISWSTVDFLKIPKLSYYGIKREISEISIGCYRSKVDMKSEHIQNTFSNGYE
LDIWGFGNDKNLTLEIEFYNELGDIYFANKIDGLNFTTNQVNTIIENHHHYHQLYDKTIV
YIKLFKNNQIIARSSDWPQPLKHLPWKKHSAVISIEHLGNGEFEITTSKPIKGFELYFQE
CNYLFNDNGKDIFPKDPQIIKVINFNQSDLSKLKYHHLGTIL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	654	8.5e-72	0.6276595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.95e-55	46	629	45	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	4.12e-06	3	405	16	397	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW31022.1|GH2	0.0	5	821	5	816
CAX39789.1|GH2	0.0	1	821	1	815
CCE41561.1|GH2	2.84e-314	5	819	4	828
CCG20510.1|GH2	2.15e-307	5	819	4	832
ABN65300.2|GH2	2.39e-256	5	818	5	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.07e-117	38	801	52	809	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	1.96e-82	38	642	41	680	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.99e-82	38	642	41	680	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	6.90e-82	38	642	39	678	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.34e-81	38	642	41	680	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NW36|MANBB_ASPFN	4.42e-160	39	819	37	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|A2QYN2|MANBB_ASPNC	4.42e-160	38	819	36	843	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	1.23e-159	39	819	37	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|Q5B7W2|MANBB_EMENI	1.69e-159	38	819	36	842	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|I2C092|MANBB_THETO	3.12e-156	6	821	11	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_040450.t1-p1.