CAZyme Information: CTMYA2_033580.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_033580.t1-p1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	CP047871|CGC11	46432.24	9.3000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047871:286403-287593(+)

Full Sequence      

MSQLKYLIGLSIILRIGFFLFGLYQDKYMAVKYTDIDYLVFNDASKFIYDGKSPYLRETY
RYTPILAMLLIPDNFNELWFNFGKVLFMISDLITGLIILKLLSKNEKLTNRKIMILSSIW
LLNPMVITISTRGSAESVLTVMIMLSLYYLLDKKNIILSSFWMGFAIHFKIYPIIYLPSV
LYYLSTKSTPFINLPILNLINKKNLSYLFVTLMTLCGINYLMFLKYDWEFIENSYLYHFS
RLDHRHNFSIYNMALYYKSSLLNGISGLDIEKLAFIPQLLISGLIIPLVFAKNDLLSSLF
IQTFAFVTFNKVITSQYFIWFLIFLPHFLSKSNMLTTNKINGVVCLLLWIGSQGSWLYFA
YKLEFLGENTLDYGLFYSAIFFFLSNCWCISQFISSL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	129	394	5.8e-85	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.91e-78	1	394	5	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.01e-63	129	394	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28981.1|GT50	1.22e-216	1	397	1	398
AAV03184.1|GT50	3.28e-216	1	397	28	425
CAX42079.1|GT50	1.35e-207	1	397	1	402
CCE44265.1|GT50	1.10e-186	1	397	1	397
CCG23660.1|GT50	5.86e-182	1	397	1	398

PDB Hits     

CTMYA2_033580.t1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMR5|GPI14_CANAL	2.17e-217	1	397	1	398	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|Q6BHI9|GPI14_DEBHA	2.40e-173	3	397	5	410	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|P47088|GPI14_YEAST	3.88e-109	10	397	11	389	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q4I073|GPI14_GIBZE	1.36e-100	7	395	13	406	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q75C82|GPI14_ASHGO	8.02e-99	11	394	12	381	GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

Start	End
7	24
78	100
113	135
162	184
205	224
274	291
303	325
340	360
373	395