CAZyme Information: CTMYA2_013410.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_013410.t1-p1
• CAZy Family: GH130
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	CP047869|CGC17	46645.37	5.1076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047869:1148300-1149508(-)

Full Sequence      

MITSKYGYAPNLSQFDSNQVQFFDLANYQGSANGWQYDERVLFCVPLRDAAAHLPMFFGH
MKNLTYPHHLIDLAFLVSDSSDDTMGELKKHLNEVQKDPNLAFGEIEIFEKDFGQSIGQG
FSDRHGFAAQGPRRKLMARARNWLWSVALKPHHSFVYWRDADVETVPPTILEDLMHHDKD
VIVPNVWRPLPDWLGNQQPYDLNSWQESEGGLQLAETLDEDACIVEGYVEYQTWRPHLAY
LRDPYGDPEVEMELDGIGGVSILTKAKVFRTGSHFPAFSFEKHAETEAFGKLSKRMGYSV
VGLPHYVIWHIYEPSSDDLKHMEWMASEEVRQQEEAKIRKVYDKVWNKAFEDVQEVWNKE
RNKFLKNTDMNNVRKIHVDWSGVDDVDIDKSLKDGKQLADFNP

Enzyme Prediction     

No EC number prediction in CTMYA2_013410.t1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	18	279	3.9e-124	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.17e-156	20	279	2	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27845.1|GT62	1.31e-282	4	403	29	428
CAX44049.1|GT62	3.32e-281	4	403	59	458
CCG25625.1|GT62	3.95e-265	8	403	68	463
CCE42119.1|GT62	5.61e-265	8	403	68	463
ABN66521.2|GT62	1.32e-262	8	403	65	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.19e-56	20	313	6	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	8.74e-208	8	381	52	425	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	2.10e-155	4	337	58	402	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	6.35e-131	8	334	160	535	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	6.08e-130	18	332	74	440	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	9.96e-66	12	313	65	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_013410.t1-p1.