CAZyme Information: CTMYA2_012790.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_012790.t1-p1
• CAZy Family: GT91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	CP047869|CGC16	47066.64	4.7061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047869:1022851-1024113(-)

Full Sequence      

MSNPSSPTQADPNSNAGEDINNTTKDVSMVDVSKADGDQQPRRRRSTLNLTDEIDLDRMN
IDNSGASQDIDDKMNIDPSSTNLQQQQQQQGGNPIPPNIPQQQQQQQQQQPVPGPEATIA
VPVDIKWVQGGQKVYVTGSFTGWRKMIGLVKQPDNNFSITLGLPVGTHRFRFVVDNELRF
SDFLPTATDQTGNFVNYIEITPDNVQQHLLQQQQQQQEGAPQQQQQQPAQEQLDLQQGEA
GRNDQQGLGGGRRASVGGRSRSNSMWGLTNDDDDMGNGYSRYYDDESTALDAKKYQYISD
IPPIFTDPKVMEQYYVAIDKQSRSNNGQQQAWLHPPQLPPHLESVILNNFNNNNENNSGA
LPIPNHVVLNHLATTSIKHNTLAVASIVRYKRKYLTQVLYAPLQPPPAPPQDNQQQEQQQ
V

Enzyme Prediction     

No EC number prediction in CTMYA2_012790.t1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.98e-40	121	205	1	84	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
214973	AMPKBI	3.14e-38	294	401	4	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
398422	AMPKBI	9.06e-29	334	401	2	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
199889	E_set_AMPKbeta_like_N	1.01e-24	122	200	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
199892	E_set_Isoamylase_like_N	1.43e-07	129	177	11	61	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX44115.1|CBM48	1.06e-183	18	404	18	394
AOW27906.1|CBM48	7.47e-178	1	404	1	399
CCE42083.1|CBM48	4.45e-145	22	403	21	496
CCG25658.1|CBM48	5.73e-141	19	403	16	445
CAG84769.1|CBM48	5.78e-141	25	404	10	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QLV_B	3.68e-86	118	403	1	252	Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae],2QLV_E Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae]
3T4N_B	1.99e-42	296	404	2	111	Structure of the regulatory fragment of Saccharomyces cerevisiae AMPK in complex with ADP [Saccharomyces cerevisiae S288C],3TDH_B Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP [Saccharomyces cerevisiae S288C],3TE5_B structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with NADH [Saccharomyces cerevisiae S288C]
4REW_B	9.02e-21	120	403	1	197	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
4RER_B	1.24e-20	120	403	1	197	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]
7JHG_B	4.50e-20	119	403	1	198	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04739|GAL83_YEAST	4.17e-90	122	404	163	417	SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL83 PE=1 SV=1
sp|P34164|SIP2_YEAST	7.59e-84	116	404	159	413	SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIP2 PE=1 SV=3
sp|P78789|AAKB_SCHPO	3.32e-26	121	400	99	293	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|Q6PAM0|AAKB2_MOUSE	1.49e-19	120	403	75	271	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|O43741|AAKB2_HUMAN	2.08e-19	120	403	76	272	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CTMYA2_012790.t1-p1.