CAZyme Information: CTMYA2_012260.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_012260.t1-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451	CP047869|CGC7	51865.94	7.1862

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047869:861499-862851(+)

Full Sequence      

MKKELKVIIWAHVALVIYLLYLCFDLLTLIPDDMFSDALLDFEINPSPNSPNLNKQAIIP
KIIHQTYKTNDIPDAWKQGQQACINLHNDYQYILWTDEMAREFISKEFEWFLETWDNYMY
PIQRADAIRYFVLYHYGGIYIDLDDGCKRKLDPLLTVPAFVRKTAPTGVSNDVMGSVPHH
PFFLKVIQNLEKYQRNWFIPYLTIMISTGPLYLSLIWKQYKRWGVPEAGKVRVMMTEHYK
GNPYSYFAIASGSSWHMGDANFIKGLGDHLVLAVIGGFLLGMAILATEYLFYCWVTSNSF
KKMINKIFSIMWSVFMGFLRFLHLDKFLTKGSLSSGGSHDYNELLPTHKDDKKTKLSSIF
NIVGHQAKIKRRNRKDSNLPIEIGLLDKLSVDTIVVEDNDNKCNKSTDSLLLSPINDINE
SPHSTPPGSPSHVTQPLLDSETINRMNDEIV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	2.8e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.46e-72	1	323	10	342	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.79e-24	73	155	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27901.1|GT32	2.93e-205	1	415	1	456
CAX44109.1|GT32	4.83e-203	1	397	1	450
CCG25834.1|GT32	3.26e-184	1	400	1	400
CCE44715.1|GT32	4.91e-184	1	400	1	400
ABN66494.2|GT32	1.00e-164	1	393	1	347

PDB Hits     

CTMYA2_012260.t1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.73e-133	1	387	1	364	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	4.26e-133	1	303	1	299	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.05e-88	52	280	75	306	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.28e-81	54	279	52	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.64e-53	59	260	64	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999379	0.000645

TMHMM  Annotations     

Start	End
7	29
197	216
270	292
307	324