CAZyme Information: CTMYA2_010320.t1-p1

Basic Information

• Species: Candida tropicalis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida tropicalis
• CAZyme ID: CTMYA2_010320.t1-p1
• CAZy Family: CE9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1108		126497.61	5.3989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CtropicalisMYA3404-2020	6136	N/A	0	6136

• Gene Location: location=CP047869:356856-360179(+)

Full Sequence      

MAYQHNQQHTPPPPGRIDFSDDEEDDLFSDDDNDNDTINQPPVTPNLITPYQRSSSSNTN
NQGIYNPFNQQQQQQQQEPSAPQNSFQTYGNNGSYHQRHNSRQGSLGTFSMSGGGQKRYS
SNLNSNSGSSSFGGTLYTNEWEENHHDKYNNLHQDNYYDEYGDEDDDMFEEKPMNFGRSK
TVKFNEPEYPPLTYSPGKKSQVNVYDYDLEENDSNSGSTLSNGNSNSLARVNTFTGDDYM
INPLLDADDDDSLDPFGDDESLFSETGEEIIRRGTTIKRSHTNKSSKTTGRKSNTDTQLN
FDDDEDDEDEDEFKPKLTYTKTIKKAKLINGNYIIDMPVPNSLLDTYGKRISTNKNNIPR
EMSFVRYTACTCGPSNFVKFNYNLRQELYEPPRTTEIMVCITMYNEDEVLLGRTLKGVFD
NIRDLTNRSDPNWGEESWKKIVVVIVNDGRLELNKRTEILLKALGIFQDGFAKSKINDKS
VKSHIYEYTSTVGIDTVNDRVHLTSNSTPVQFLFCLKEKNSRKINSHRWCFQAFGPIIKP
KVIMLLDCGTKPSKDAFFYLWRAFKDENVAGACGEMRTALGPSKKLLINPLVAAQNFEYK
ISNVLDKPMESVFGFISVLPGAFSAYRYEALLNVNGEGPLEKYFKGEYLHQDTQVDEDED
DDERDIKEKNFEEAGIFTSNMYLAEDRILCFELVAKKNHNYILRYVNEAKAETDVPENID
EFVLQRRRWLNGSMFAAGYAVFHWTKIWRSNHSLFRKLFLQLEFYYQLVTILVSWFSLAS
FFLVFRILTANLGADDMNFNVGKYLAIIFLWFYVGSVVCTFVLAFGNTPRGTKKFYLVIA
IFFAVLMAYMMFAAIFLAVHTVTSIVSDHKTDFSIVLVFTNTKFRDLVVSMVSTYVLYFV
GALMYGEPSFMFTSFVQYVLLSPTYINVLNIYAFCNIHDVSWGTKGVEQAKDLGAAKSFG
KNNDELVMIAPENHTEELNDKYLNALESLRVIPPQIIPSNVKKSKDDSYYAFIRTITVLV
WMLTNAILIAIVLEAGGVDIISNKNSTNADGSISGNSQIFLTIILWIVAGLALFRFLGAF
LFLIFKGFRPLKWKLKERKVKKKKNKSN

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	403	564	2.2e-63	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	5.66e-84	403	564	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	4.53e-80	399	736	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.09e-31	513	865	115	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	4.84e-30	325	402	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	6.61e-17	401	636	3	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28121.1|GT2	0.0	168	1108	139	1102
AAO37822.1|GT2|2.4.1.16	0.0	168	1108	139	1102
CAX42595.1|GT2	0.0	168	1108	141	1105
CAR65388.1|GT2	0.0	178	1100	107	1019
ABN64422.2|GT2	0.0	233	1099	2	857

PDB Hits     

CTMYA2_010320.t1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	2.82e-277	320	1092	234	1002	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30601|CHS2_EXODE	3.37e-241	290	1084	153	914	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30583|CHSC_EMENI	7.38e-231	321	1089	175	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30588|CHS3_NEUCR	1.56e-227	321	1089	148	886	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P08004|CHS1_YEAST	8.28e-226	323	1091	375	1128	Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
763	785
805	827
837	859
887	905
915	937
1010	1032
1063	1085