CAZyme Information: CPSG_10113-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_10113-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1013		116512.80	8.8912

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636525:46477-49887(+)

Full Sequence      

MPPQGSVGMMSFHLWAFWLIFCYRYVRLIVNLWAYHRLKPIPPPGPLGPADVTVVIPCLN
IDRQRLAETLKSILKNDPQKVILVTVKEEQGVAEEVMGMVRPCWVELQVATVQQCGKRRQ
LVAGIQLVATDITVLADDDVIWESPHLLKWILAPFKREKMGGVGTCQRLQHDPLQGLWRR
VWSFLGALYLERRNFDCAATTYMDGGMPCISGRTAAYRSEILQGPEFLDAFGGETWQGKQ
LQPDDDNFITRWLDSHFWDMHFQYHPEALVLTTLKDNWGYLKQCLRWSRSNWRSNLRSLF
CERFIWRRHAYSTYAVFLITLSPPAFLVESALIWLCHRATENDPVAHRWALRLLLLWMFL
TKVIKFLGYFKRNPSDIALIPISVLFGYFHGILKVYAACTLHVTSWGTRDMPTREPKLGN
NDTPNQRAPDTLGSWWHSFNAKERLTPWRRRTIFFWTNAWPAGQPRLQLRLLGVGMCLLA
ERALNVLMPLRVGQIMSRLSKSSNLPEEIYHLAFLHFLEPGYLIASVRTYLLLPLEHYWD
RRLKINTFAKVMSFPSEFDEAWDLATLSDVISDVGCFEAVISLTIFMLIPVLSDTILTFT
SIYYQLGSRAAVSFAVIMGSYIFLSGKLRSQRHNRWKIYRDSIRREKEACRGSIFNWRTV
ICFGRLEQEITRFQNTVDARLNSSQHPAALSILRGALQFLVYTAGPAGCVMITRNMSEVA
TMFIFLARLREPLENMQSFLDAIHLELAKVDSLIEISEKETSVCYQRQKVLLVNQGNTHW
SIEFKSVDFSYNKQCQVLEGLSFRVPGGETIAFVGESGSGKSTILNLLLQLHFPQRGSIQ
INESDISESQKEGITFVPQKPSFFSDRSIMENLKYANSNVEDAEIRKICHSLLIHDRIQR
CPEGYNTRYQDAMFSGGEQQRLAIARALTRDARIFLLDELTNSQDNKTASCILDVLKSRA
NGRTTILVSEIKNVHRIFFLNKGRVVEQGKHEELVDLKGQYYKLWSIQQQAGE

Enzyme Prediction     

No EC number prediction in CPSG_10113-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	289	2.8e-43	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	1.94e-99	51	294	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224055	MdlB	1.70e-78	467	1011	12	567	ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms].
213220	ABCC_ATM1_transporter	1.21e-73	782	1008	1	236	ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C. ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
213216	ABC_MTABC3_MDL1_MDL2	3.08e-66	782	1008	1	238	ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins. MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
213221	ABCC_Glucan_exporter_like	4.64e-65	782	999	3	229	ATP-binding cassette domain of glucan transporter and related proteins, subfamily C. Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virulence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM10758.1|GT2	0.0	9	1013	1	1005
QGA21882.1|GT2	3.02e-137	16	410	8	408
QQK43830.1|GT2	4.46e-134	16	410	8	407
BCS16742.1|GT2	6.26e-134	16	410	8	407
QKX54999.1|GT2	9.21e-133	16	410	8	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D7N_A	1.54e-47	434	1009	237	826	Cryo-EM structure of human ABCB6 transporter [Homo sapiens],7D7N_B Cryo-EM structure of human ABCB6 transporter [Homo sapiens],7D7R_A Cryo-EM structure of the core domain of human ABCB6 transporter [Homo sapiens],7D7R_B Cryo-EM structure of the core domain of human ABCB6 transporter [Homo sapiens],7EKM_A Chain A, ATP-binding cassette sub-family B member 6, mitochondrial [Homo sapiens],7EKM_B Chain B, ATP-binding cassette sub-family B member 6, mitochondrial [Homo sapiens]
7EKL_A	3.65e-47	434	1009	237	826	Chain A, ATP-binding cassette sub-family B member 6 [Homo sapiens],7EKL_B Chain B, ATP-binding cassette sub-family B member 6 [Homo sapiens]
4MYC_A	1.58e-42	460	1009	3	578	Structure of the mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C],4MYC_B Structure of the mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C],4MYC_C Structure of the mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C],4MYH_A Structure of the Glutathione bound mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C],4MYH_B Structure of the Glutathione bound mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C],4MYH_C Structure of the Glutathione bound mitochondrial ABC transporter, Atm1 [Saccharomyces cerevisiae S288C]
7PSL_A	1.78e-42	460	1009	9	584	Chain A, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C],7PSL_B Chain B, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C],7PSM_A Chain A, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C],7PSM_B Chain B, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C],7PSN_A Chain A, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C],7PSN_B Chain B, Iron-sulfur clusters transporter ATM1, mitochondrial [Saccharomyces cerevisiae S288C]
7N58_A	1.65e-41	580	1008	272	714	Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N58_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N59_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N59_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5A_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5A_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5B_A Chain A, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana],7N5B_B Chain B, ABC transporter B family member 25, mitochondrial [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MWY1|GT2_MAGO7	1.38e-104	16	429	35	441	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1
sp|F9WWD1|GT2_ZYMTI	7.55e-102	15	410	9	401	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1
sp|I1RB03|GT2_GIBZE	2.84e-100	6	409	21	433	Type 2 glycosyltransferase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GT2 PE=2 SV=1
sp|Q2UPC0|ACLQ_ASPOR	2.42e-61	405	1013	180	792	ABC transporter aclQ OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aclQ PE=3 SV=1
sp|Q02592|HMT1_SCHPO	1.19e-51	434	1013	238	824	Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmt1 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000002

TMHMM  Annotations     

Start	End
5	27
311	333
348	370
377	399