CAZyme Information: CPSG_09707-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_09707-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		25764.11	8.8867

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636512:103617-104574(+)

Full Sequence      

MLIKSLLLAALLSAECMALGRKVPSNVKDLYNYAKNHRCRKPLSSSFQDGHGRKGFVYCG
DRLDSQGIIYITGPSNSRGLADMDVDCDGANRSAGDCKNDPSGQDQTAFKDEVKKYGIPD
LDSNKHGYVVLGNEGSSPSFNPAKYGIKPLSVVAVFYGVWGDTNGGTLVGETSVSLAQAC
FPKEGLNGDNGHEKHDVLYIAFKGNAAKPGAKGANWKAKNFAGFEKSLEHIGNKLVKKVS
A

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	15	237	1e-68	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	5.42e-92	83	238	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI17114.1|GH75	1.06e-81	8	241	6	235
QGI66296.1|GH75	4.93e-80	22	239	20	233
QGI97180.1|GH75	4.93e-80	22	239	20	233
QGI83540.1|GH75	1.99e-79	22	239	20	233
ABY77913.1|GH75|3.2.1.132	1.27e-78	22	241	2	217

PDB Hits     

CPSG_09707-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	1.67e-82	9	241	7	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	8.68e-75	23	236	20	236	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	3.22e-73	23	236	20	240	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	3.22e-73	23	236	20	240	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	1.47e-72	18	236	15	233	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999735	CS pos: 18-19. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in CPSG_09707-t26_1-p1.