CAZyme Information: CPSG_06611-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_06611-t26_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: UDP-glucose:sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		69535.69	5.1552

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636496:199966-201911(-)

Full Sequence      

MDNASVFYRILTSISLLPTNQRSMSNTFWRLCELLAQQEKEDADNGGSEAYENEPDDSLF
PELTRALDGSASSSNNYDLEPSEASNLSPPEAAPIHFDDPCASIVNFKPSESLRITCLTI
GSRGDVQPYIALCKGLLAEGHKPRIATHREFEPWVRQHGIDFAPVEGDPAELMRICVENG
MFTYSFLKEASLKFRGWIDDLLSSAWSSCQGSDILIESPSAMAGIHIAEALRIPYFRAFT
MPWTRTRAYPHAFAVPDHKMGGAYNYMTYVMFDNVFWKAIAGQVNRWRKRQLGLRGTNLD
KMQPNKVPFLYNFSPSVVPPPMDYGDWIRVTGYWFLDEGSSWSPPEQLTAFIQKARNDRK
RIVYIGFGSIVVSDPTALTKTVIESVLKADVRCVLSKGWSDRLGDPSSAKTEVPLPPEIY
QITAAPHDWLFSQVDAVAHHGGAGTTGASLRAGVPTIIKPFFGDQFFFGTRVEDLGVGIS
LKKLNVNVFSRALWEATNSERMIVKAKLLGEKIRKENGVEKAIQALYRDLEYAKTLVRRR
SIAAASPPLPVPLGSPKARHDWEDDLAGIEDTWTLVGHPDIDMELSQSSKGRESEFDLRA
SAALATGTLPDIVVDEDDGEEDVTR

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	115	528	4.1e-58	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.08e-77	113	526	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.67e-53	114	526	3	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	8.60e-32	115	250	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	9.01e-10	118	486	1	344	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	4.93e-07	277	487	217	418	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51257.1|GT1	3.56e-290	34	609	903	1481
QSS69260.1|GT1	3.89e-289	34	609	902	1480
QMW35213.1|GT1	7.08e-289	85	592	859	1365
QMW47275.1|GT1	7.08e-289	85	592	859	1365
QRD91604.1|GT1	7.72e-289	85	592	862	1368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	6.26e-192	106	540	13	449	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.26e-191	106	540	33	469	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	4.51e-21	113	480	1	348	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.55e-17	121	480	9	331	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.10e-16	113	480	1	349	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CYS1|ATG26_NEOFI	5.78e-291	78	611	881	1408	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q0CKU4|ATG26_ASPTN	6.10e-291	90	592	876	1375	Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atg26 PE=3 SV=1
sp|Q4WID6|ATG26_ASPFU	1.58e-290	78	611	872	1399	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2
sp|Q2U0C3|ATG26_ASPOR	1.37e-289	85	592	862	1368	Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg26 PE=3 SV=2
sp|A1CFB3|ATG26_ASPCL	4.14e-288	91	592	884	1384	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CPSG_06611-t26_1-p1.