CAZyme Information: CPSG_06241-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_06241-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937		101641.47	5.6915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636495:228979-232593(-)

Full Sequence      

MAAAREEESLPEWDCNELDRQMGQLFVMGFDGTSVDPQIRSLIEDYRLGSIILTAKNLKS
AEETTKLVLELQTIARDAGHPAPLMIGLDQENGGVNSLFDEIYIRQFPSAMGIAATGSKS
LAREVAKATAQELSAVGVNWILGPVLDVLNNARSQPLGVRSIGDDAQEVSAYGVEFMKGY
QEAGLVTCGKHFPSYGNLEVLGNQTDVPVITDTLEQLSMSALVPFRNAIAQGIDSMMVGG
CAMSSAGVNVMHACLSEQVVDDLLRKDLNFNGVVVSECLEMEALSFNIGVGGGTVMAMKA
GCDLILLCRSFSVQQEAINGLRLGVENGIINKERIRQSVQRVLDMKARCTSWEKALNPAG
ISLLSQMQPSHTNLSTRAYNSSITIVRDKNNLLPLTSVLEPDEELLLLTPLVKPLPASAV
SLSITESSRETVLSTDTVSWERSASVMSGESVFREFGRSLARHRNGRVLHTSYTANGVRP
VHENLINRASGVIVVTADSNRNLYQYGFTKHVAMICNAQFAANGDRRSKPLVVVAVSSPY
DFATDQSIGTYVCTYDFTETALQALVKVLYGDLTATGVLPGTLSRSQKLHQSRQHWLVEN
WNEDRDANALDELLTAIREDSTHNQRSALAGVTSNTFLLRNSDVEEAHFVVRNSSTQALY
GFCSTYFFKSTGTAVIGALIVDPGRRKLSIGNSLHNRAIRSLMQRQGVRRFQLGSRLPGV
YLGIPTGNPVERKRLRQWFASLGWNTSLSRPVCTMILPNLGEWTPPEGLTRTLKSAEVSY
DLVYGLDYAEAILDHVKTNSRQGVMEIYKMALSGSSANGIIRAKRNGDDAILGTVVVYTS
ESTLAEFVPTVKEARPMGGGISSAVISPSAGEYSTIVQGLILLGIKQLRSQGASAVVLDC
VDGDGNFDGLSAMGFSTLHSFEEVTCDAATWNMLTSS

Enzyme Prediction     

No EC number prediction in CPSG_06241-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	82	306	1.4e-53	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.27e-72	18	396	3	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.76e-65	18	343	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	6.00e-33	22	354	1	315	beta-hexosaminidase; Provisional
178629	PLN03080	3.37e-11	107	395	114	415	Probable beta-xylosidase; Provisional
185053	PRK15098	4.31e-10	106	346	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	20	937	7	924
BCS15461.1|GH3	0.0	3	937	2	931
BAE65506.1|GH3	0.0	1	937	29	961
QMW48185.1|GH3	0.0	3	937	2	932
QMW36125.1|GH3	0.0	3	937	2	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	8.37e-91	16	744	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.58e-65	18	584	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	9.24e-43	18	394	44	446	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.22e-42	18	394	18	420	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.78e-42	18	394	48	450	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.76e-42	18	394	44	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	5.70e-37	19	396	29	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.19e-32	33	584	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	3.46e-29	32	318	12	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	1.01e-25	25	308	1	278	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CPSG_06241-t26_1-p1.