CAZyme Information: CPSG_06127-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_06127-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		52817.23	7.8327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636494:1103912-1105389(+)

Full Sequence      

MTVPFPSRRIYRISCLIITPCLVAIIGMGIFGLWFGMNSDGDNVHPLLTQLIPAGHCTCK
ASTTFNCTSCVDPITPTTFETASPSLSPSPPAWTFVYGRDDRNVGLTRSQCQSSFPGLFE
DVHRAVRFWASRDGIQKESLDGIKLRGGMARAMIFNGNLYVIETRAAQEDHRRKILGVLS
SIHRALQDNVPDIEFIFSIEDRVDDVSGTGQPLWVLGRKASEESVWLIPDFGFWAWGNPS
SNIGPYDQVVETIERIDSEDRMPWSSKTQKLLWRGKLSFSPKLRRGLLEAARNKPWGDVK
ELVWKKKDNFISMQNHCKYMFVAHVEGRAFSSSLKYRQACRSVIVAHKLQYIQHHHYLLQ
SDGPHQNFVEVERDFSDLSEKMSELLANPEMARKIADNSVKTFRQRYLTRAAEACYWREL
WEGWASASRGNPMPDELPDERGLRYESFLLLESSDMMAFSYKP

Enzyme Prediction     

No EC number prediction in CPSG_06127-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	190	425	6.5e-20	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	3.22e-22	112	432	3	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	4.25e-19	190	429	2	254	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS76484.1|GT0	8.24e-209	17	461	11	456
BCR89787.1|GT0	3.54e-183	30	461	30	454
QMW31614.1|GT0	3.94e-182	1	460	1	459
UDD60541.1|GT0	3.94e-182	1	460	1	459
BCS06430.1|GT0	5.59e-182	21	459	18	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.68e-07	190	436	128	387	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	5.08e-08	189	420	137	380	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q6UW63|PLGT2_HUMAN	2.55e-07	158	432	197	471	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	6.61e-07	190	436	138	397	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|Q8T045|RUMI_DROME	8.81e-07	190	436	140	399	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.52e-06	190	420	137	381	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000004	0.000001

TMHMM  Annotations     

Start	End
13	35