CAZyme Information: CPSG_04989-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_04989-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		52219.25	5.0410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636492:566511-567920(+)

Full Sequence      

MSSLLFIILLGGSLVSLSSQTDLQSDVSTSNSTTERVAQHIVAPKCDCYVVSGPEPGYFQ
HYRFYDFRPAPARDTPKKGMKKKNDKKEKDRENMGPTGINSRHHALNGHAFFKEWNIQSW
HRVGSTLFPISIVHSYDNVYITEGKASSSDGSYHLVLRSTRHEEYTSTAEVQTSAENILH
CSYRVRMRLYSTSQGGSGKILPPPGGAVAGIFTYHSRNSESDIEILTIDPPNRVHYSNQP
DWDPTTDEMIPEASDDIDIEVPWTDWADHRLDWLPMQSRWFLNNDLVLEKDYGVPSSPSA
LVLNLWSDGGQSVYMGVEWIQIAYNTSTQHVGETHDPHTQYVGHGNRWGERFRSYFWRSR
WRHRFNLGRMKPAAGEPEKDPEGNDGNPDGRPVQQEDQDRDYDYDQGEYASDYDHEDSHS
GDRDGGNPSEKLECAVVCQIDDVGMTGVPEVVWDASWEQH

Enzyme Prediction     

No EC number prediction in CPSG_04989-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	113	321	3.3e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.49e-31	115	322	13	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	7.77e-06	149	320	37	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75565.1|GH16_22	1.59e-93	45	454	41	445
QSS58825.1|GH16_22	3.53e-92	45	454	41	445
QSS53837.1|GH16_22	4.98e-92	45	454	41	445
QKX57994.1|GH16_22	2.06e-80	27	325	20	359
QMW33413.1|GH16_22	6.60e-77	46	328	34	336

PDB Hits     

CPSG_04989-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CPSG_04989-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000541	0.999411	CS pos: 20-21. Pr: 0.6743

TMHMM  Annotations     

There is no transmembrane helices in CPSG_04989-t26_1-p1.