CAZyme Information: CPSG_04011-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_04011-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: DUF1237 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550		61282.26	5.1801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636490:1048113-1049901(-)

Full Sequence      

MKLSLKLVALLTAALCSRVVTGTEPPLEDDPDDLAEACPDYTEYAAERHPPYSEGPLKLP
FQRPAEVCRTFSSPYVEKVIEDVTSRMVDKDLARIFQNAFPNTLDTTVKWHIKGSEEAKK
SKKSKKKKGANPAAWEGPQSFIVTGDINAEWLRDSTNQLAQYQVLSKKDPNIKNLILGAI
NTQAEFVIQSPYCNAFQPPPASQLPPTNSGQEDSVHPVYEPTVVFECKYELDSLANFLSL
GNQFYEHSGSSAFLTGRWYQALDTVLNVIQAQSESTFDEYGSYVRNEYTFQRTTDIGTET
LNLGGIGNPLNNETGLVRSAFRPSDDATIMGFFIPANAMMAVELKRTANVLQETGGNAEL
IDRLRGLSKRIEQGVWEHGVVTHKKYGEVFAFEVDGYGSFVLMDDANLPSLLALPLLGFV
KEDDKVYQNTRRMILSKSGNPYYLVGSAFHGIGGPHIGVKNAWPMSVLVRARTAQSDEEI
MESINMVRDSSLLGLIHESVNVNRIQQYTRSWFAWANSVFAQTILDLAERKPHLLFGENA
RPYKVADVEL

Enzyme Prediction     

No EC number prediction in CPSG_04011-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	89	525	2.7e-163	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	89	525	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.81e-151	68	535	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM13217.1|GH125	0.0	1	550	1	550
QRD90853.1|GH125	8.98e-267	27	545	24	536
QMW43832.1|GH125	8.98e-267	27	545	24	536
QMW31801.1|GH125	8.98e-267	27	545	24	536
UDD60757.1|GH125	8.98e-267	27	545	24	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.28e-95	63	535	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.92e-91	63	535	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	4.36e-91	63	535	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	3.88e-79	76	526	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	6.13e-79	76	526	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	8.16e-183	36	535	25	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000182	0.999783	CS pos: 22-23. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in CPSG_04011-t26_1-p1.