CAZyme Information: CPSG_01038-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPSG_01038-t26_1-p1
• CAZy Family: AA5
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32956.40	6.6383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiSilveira	10379	443226	154	10225

• Gene Location: location=GL636486:2748037-2749170(-)

Full Sequence      

MRLSTLLPLALAAVPSVSAAGKLGFALGVKNADGSCKSQADFEKDFDVLKAHSNIVRTYA
AADCNNAEAIVPAAKKKGFNLVLGVWPDVLESFDADTKALQKVIPGNEDVITAITVGSET
LYRGNFTGQELLQKINQVQKMFPKVKVGTADSWNKYADGTADPIIAGGVKYLLVNAFAFW
QGQDISNATDTYIDDMMQAMVHIQKVAGANAKQIHIATGETGWPSDGGSDFGAAKAGTKN
AKTFFEKGVCAMLSWGVDVFYFEAFDEPWKPKSIGDNGKAADETHWGLYTADRQSKYTPV
CKHIRS

Enzyme Prediction     

No EC number prediction in CPSG_01038-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	298	2e-42	0.9839228295819936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.64e-73	16	293	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.96e-46	23	297	1	305	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12021.1|GH17	2.49e-225	1	306	1	306
EER28012.1|GH17	3.40e-223	1	306	1	306
QSS60378.1|GH17	5.18e-162	1	301	1	302
QSS49555.1|GH17	2.11e-161	1	301	1	302
QSS68032.1|GH17	2.99e-161	1	301	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.60e-42	33	296	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.51e-41	33	296	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	4.12e-08	187	297	275	381	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.26e-152	1	302	1	302	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	1.07e-74	16	302	15	306	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.21e-73	16	302	15	306	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	1.41e-73	1	301	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	8.24e-66	21	301	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999771	CS pos: 19-20. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in CPSG_01038-t26_1-p1.