CAZyme Information: CPC735_070830-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_070830-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: endochitinase 1 precursor, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36193.04	5.9836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000009:1080236-1081421(+)

Full Sequence      

MCFTLLHGMNQPRCVFESGMVLGVSKQLSDEWADDQMPVDGTQGCIRAFTQLKGQYTGMK
VILSIGGGGTGSQHFATVAKDPIALQNFIQSAKNMVDRFGLDGLDIDWEHPSDSQQGEDY
VNLLRLLREGLPWPQYTLTTALPAGEWALRHINLIHAQCYVDLINLMTYDFSGPWTPHSG
HQSQLFSPHIPHSEAAGISCHSGISYVLAQGVPSSKILLGISVYGRAFPGTTGVGQTHCI
SNETPEDKIVFDYCDLPLPGSVEQHDDRLCAAFCVDRNVGFVSYDSTRTVVQKAKFVREM
ALGGLFYWHVAADAVGKRSLVAAGYSALHDL

Enzyme Prediction     

No EC number prediction in CPC735_070830-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	55	321	2.3e-59	0.7905405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	6.87e-74	23	313	40	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	3.04e-72	27	313	43	334	Glyco_18 domain.
395573	Glyco_hydro_18	2.31e-68	40	313	44	307	Glycosyl hydrolases family 18.
225862	ChiA	2.29e-58	43	329	111	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	5.10e-53	25	308	43	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACT90641.1|GH18	1.13e-230	27	331	78	382
QVM13509.1|GH18	1.13e-230	27	331	78	382
UBR88483.1|GH18	1.01e-127	28	331	73	371
QGA20822.1|GH18	6.95e-127	23	331	81	387
QRD87865.1|GH18	1.77e-125	28	331	72	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D2K_A	7.83e-52	28	321	47	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	2.17e-51	28	321	47	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	4.27e-51	28	321	47	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	1.98e-47	32	331	93	401	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
1WNO_A	2.13e-47	28	328	50	366	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G5EAZ3|CHIB1_EMENI	3.44e-55	28	324	49	358	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q92222|CHIB_EMEND	3.44e-55	28	324	49	358	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|Q1E3R8|CHI1_COCIM	8.87e-51	28	321	82	391	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	8.87e-51	28	321	82	391	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	9.42e-50	28	321	82	391	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000070

TMHMM  Annotations     

There is no transmembrane helices in CPC735_070830-t26_1-p1.