CAZyme Information: CPC735_059270-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_059270-t26_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	ACFW01000049|CGC17	49086.87	5.5073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000049:4750235-4751645(-)

Full Sequence      

MSSLLFIILLGGSLVSLSSQTDLQSDVSTSNSTTERVAQHIVAPKCDCYVVSGPEPGYFQ
HYRFYDFRPAPARDTPKKGMKKKNDKKEKDRENMGPTGINSRHHALNGHAFFKEWNIQSW
HRVGSTLFPISIVHSYDNVYITEGKASSSDGSYHLVLRSTRHEEYTSTAEVQTSAENILH
CSYRVRMRLYSTSQGGSGKILPPPGGAVAGIFTYHSRNSESDIEILTIDPPNRVHYSNQP
DWDPTTDEMIPEAILEKDYGVPSSPSALVLNLWSDGGMWSGNMSVGQSVYMGVEWIQIAY
NTSSQHVGETHDPHTQYVGHGNRWGERFRSYFWRSRWRHRFNLGRMKPAAGEPEKDPEGN
DGNPDGRPVQQEDQDRDYDYDQGEYASDYDHEDSHSGDRDGGNPSEKLECAVVCQIDDVG
MTGVPEVVWDASWEQH

Enzyme Prediction     

No EC number prediction in CPC735_059270-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	113	253	2e-39	0.6203703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.20e-24	115	298	13	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75565.1|GH16_22	1.08e-76	45	430	41	445
QSS58825.1|GH16_22	2.34e-75	45	430	41	445
QSS53837.1|GH16_22	3.30e-75	45	430	41	445
QKX57994.1|GH16_22	2.72e-70	27	301	20	359
QGA14506.1|GH16_22	2.32e-64	46	305	44	364

PDB Hits     

CPC735_059270-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CPC735_059270-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000541	0.999411	CS pos: 20-21. Pr: 0.6743

TMHMM  Annotations     

There is no transmembrane helices in CPC735_059270-t26_1-p1.