CAZyme Information: CPC735_047560-t26_1-p1

Basic Information

• Species: Coccidioides posadasii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides posadasii
• CAZyme ID: CPC735_047560-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	ACFW01000049|CGC11	57271.27	6.3790

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CposadasiiC735deltSOWgp	7255	222929	26	7229

• Gene Location: location=ACFW01000049:994494-996333(-)

Full Sequence      

MPSLESPHKEDPRLLLVSNRLPITIKRSDDGKYDSSMSSGGLVSGLSGLSKTTRFQWYGW
PGLEVPEDEIEIVTKRLKDEYNAVPVFIDDELADRHYNGFSNSILWPLFHYHPGEITFDE
SAWNAYRDANRLFAKAIAKDVRDGDLVWVHDYHLMLLPSMLREEIGETKSNVKIGFFLHT
PFPSSEIYRILPVRNELLLGVLHCDLIGFHTYDYARHFLSSCSRILGLSTTPNGVEFQGK
MVSVGAFPIGIDPDKFSEGLKKEKVQKRIAQLEQKFQGVKLMVGVDRLDYIKGVPQKLHA
LEVFLTDHPEWIGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTVEFMPIHFM
HKSVNFDELIALYAVSDACIVSSTRDGMNLVSYEYIATQHKRHGVLVLSEFAGAAQSLNG
SIIVNPWNTEELAAAYQEAVTMSDEQRALNYSKLEKYVHKFTSAFWGQSFVSELTRISAH
GEKKLLLRRSSVAPNAAADVINNDVDGH

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	9	476	5.1e-201	0.9789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	13	502	2	485	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	0.0	10	486	9	487	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215556	PLN03064	0.0	13	494	95	575	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	0.0	8	480	11	483	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
274112	trehalose_OtsA	0.0	13	476	1	456	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51129.1|GT20	0.0	1	498	1	498
QSS69129.1|GT20	0.0	1	498	1	498
QSS63365.1|GT20	0.0	1	498	1	498
ARB51347.1|GT20	0.0	1	502	1	500
QRD82299.1|GT20	0.0	1	492	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	0.0	1	499	1	499	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	6.03e-291	13	477	1	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.08e-285	11	479	10	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.54e-252	13	474	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	6.26e-252	13	474	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59921|TPS1_EMENI	0.0	1	492	1	492	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tpsA PE=3 SV=1
sp|Q4WLM9|TPS1A_ASPFU	0.0	1	499	1	499	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|Q00075|TPS1A_ASPNG	0.0	1	495	1	496	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger OX=5061 GN=tpsA PE=1 SV=1
sp|A0A384JAD8|TPS1_BOTFB	3.28e-297	1	484	1	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TPS1 PE=1 SV=1
sp|Q00217|TPS1B_ASPNG	3.48e-286	11	478	11	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger OX=5061 GN=tpsB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CPC735_047560-t26_1-p1.